(data stored in ACNUC7421 zone)

EMBL: CP000431.PE261

CP000431.PE261       Location/Qualifiers
FT   CDS_pept        complement(336038..336454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92097"
FT                   /db_xref="GOA:Q0SK39"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK39"
FT                   /protein_id="ABG92097.1"
FT                   /translation="MESLALASTVFEHFAPTTTRRRPPRTERVDGRARDLVPARAPSIH
FT                   LRVVVTWVSIFPLVTLGMTVMTLSGPITSTWPTWLRALSLTGVVVPTAVYLVVPRVLDL
FT                   SVRWMTWRCRRSAGAESCESLQAARAMRSHSHQY"
     atggaatctc ttgccctcgc atctacggtg ttcgaacatt tcgctccgac gaccacgagg        60
     cgccggcctc cgcgaacgga acgtgtcgac gggcgcgctc gggatctcgt gccggcgagg       120
     gccccgtcca tccacttgcg ggtggtcgtc acttgggtgt ccatcttccc gctcgtcacg       180
     ttgggtatga cggtgatgac cttgtcgggc ccgatcacaa gcacctggcc gacatggctg       240
     cgggctttgt cgctcaccgg tgtcgttgtt cccaccgcgg tgtacctcgt ggtgccgcgc       300
     gtgcttgatt tgtcagtccg gtggatgacc tggcggtgcc gacgctctgc cggtgctgag       360
     tcctgtgaga gcctgcaggc ggcacgcgcg atgcgctcgc actcgcatca gtattga          417
//

If you have problems or comments...

PBIL Back to PBIL home page