(data stored in ACNUC7421 zone)

EMBL: CP000431.PE262

CP000431.PE262       Location/Qualifiers
FT   CDS_pept        336560..337249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00262"
FT                   /product="probable transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92098"
FT                   /db_xref="GOA:Q0SK38"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK38"
FT                   /protein_id="ABG92098.1"
FT                   /translation="MAWDTERTKRLLIEAGVAEFSSFGLAGARVDRIAAKAGVNKERIY
FT                   QYFGKKEAFFSAVLEHELATTLAAVELSGHGVVAIADYAGRRFDYQREHPTFTRLLFWE
FT                   GLELEAPVAEASRQKHAQAIVASAREAVPELSESDAQELLITVITLVDGWVALQTADRL
FT                   FSPPLPRGRDRDSRRRDFIVMTVEAATRAALTRSQSARTQPTAGSPRMGDAGSALRSSR
FT                   ADRAGKV"
     gtggcgtggg ataccgaacg aaccaagaga cttctcatcg aggccggggt tgcagaattc        60
     agttcgttcg ggttggccgg tgcccgtgtc gatcggatcg ccgcgaaagc aggcgtgaac       120
     aaagagcgca tctaccagta cttcggcaag aaggaagcct tcttcagcgc ggtcctcgaa       180
     catgaactcg caaccacgct tgccgctgtc gagctgtccg gtcacggggt cgtcgccatc       240
     gccgactacg ccggtcgccg attcgactac caacgcgagc accccacttt cacccgtctg       300
     ctgttctggg aaggactcga actcgaggca cctgtcgcgg aagcatcgcg acagaagcac       360
     gctcaggcga tagtcgccag cgcgcgggaa gctgtccccg aactttccga gagcgacgcc       420
     caggaactgc tcatcaccgt gatcaccctc gtcgacggct gggtagctct ccagaccgca       480
     gaccggctgt tttcgccacc tcttccgcgt ggccgcgacc gtgactcgcg ccgacgcgat       540
     ttcatcgtga tgacggttga ggccgccacg cgagccgcac tcacccgaag ccagtcggcc       600
     cggacccaac ccaccgccgg ctcgccgcgg atgggtgatg cgggttccgc attgcggtcc       660
     tcccgagcgg atcgagctgg caaggtctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page