(data stored in ACNUC7421 zone)

EMBL: CP000431.PE264

CP000431.PE264       Location/Qualifiers
FT   CDS_pept        338405..338959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK36"
FT                   /protein_id="ABG92100.1"
FT                   /translation="MRSGKFPRMETASWVGAAAAVLFGATTAAAWRKAALADQARREAE
FT                   VALDVALEQVTALTRIAEAAQRAFPQPEHVEFEVQRIRGPVDRFRLRNVGTGIATDVRF
FT                   VVDPVEEQNRRIPTPQWLQEEPVTLLPKEWADFAASALSPVSGSWRIVFPAFVTVICDE
FT                   AGAPQRVDLPTVVVAEDGVIG"
     atgcgttcgg gtaagtttcc gcgcatggaa accgcatcgt gggtcggcgc ggcggctgcg        60
     gtgctgttcg gtgccaccac agccgcagcc tggcggaagg cagccctcgc cgatcaggcc       120
     aggcgtgagg ccgaagttgc gctggacgtg gcgctcgaac aggtcaccgc gttgacccgg       180
     atcgccgaag ccgcgcagcg agcattccca cagccggagc acgtcgagtt cgaagtccag       240
     cgcatccgtg gccccgtcga ccggttccgg ctccgcaacg tcggaacggg tatcgccacc       300
     gacgtgcggt tcgtcgtcga tccagtcgag gagcagaatc gccggattcc cacgccgcaa       360
     tggctgcagg aagaaccagt cacgttgctg ccgaaggagt gggccgactt cgccgcgagc       420
     gcgttgtcgc ccgtcagcgg ctcgtggcga atcgtgtttc cggcgttcgt caccgtgatc       480
     tgcgacgaag ccggcgctcc gcaacgggtg gacctgccaa cggttgtcgt tgccgaggac       540
     ggcgtgatcg gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page