(data stored in ACNUC7421 zone)

EMBL: CP000431.PE265

CP000431.PE265       Location/Qualifiers
FT   CDS_pept        complement(338994..339521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00265"
FT                   /product="possible transcriptional regulator, PadR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92101"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK35"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92101.1"
FT                   /translation="MAERPLNATAASLLGFLHEGSKTGWDLVVTAQERIGKFWSITTSQ
FT                   VYRELAAMERGGLIEAGERGARERKPYTLTEDGRRAFAEWIERDPAPENIRYPMLLTVA
FT                   FGAHLPPERLAAMLDSHRAAHESQLAEYERDAAVHGSNRFALATLDFGIVYERAVLEWF
FT                   DRVGNRLGQESR"
     atggctgaac gtcccctcaa cgccactgcg gcatcgctcc tcgggttcct gcacgaggga        60
     tcgaaaaccg ggtgggacct ggtggtcacc gcgcaggaac gaatcggcaa gttctggtcg       120
     atcacgacca gccaggtgta tcgggagctc gccgcaatgg agcgtggagg gttgatcgag       180
     gcgggggaac ggggcgcccg agagcgcaag ccctacacgc tcaccgagga cggtcgccgg       240
     gcgttcgcgg agtggatcga gcgcgacccc gcgccggaga acatccggta tccgatgctg       300
     ctcaccgtcg cgttcggtgc gcaccttccg cccgagcggt tggccgcgat gctggactcg       360
     caccgcgcag cgcacgaaag tcagctcgcc gagtacgagc gtgacgccgc ggtccacggt       420
     tccaaccgat ttgcactggc cacgctcgac ttcgggatcg tgtacgaacg tgcggtactc       480
     gaatggttcg atcgcgtcgg gaaccgtctg gggcaggaaa gtcgttga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page