(data stored in ACNUC7421 zone)

EMBL: CP000431.PE266

CP000431.PE266       Location/Qualifiers
FT   CDS_pept        339520..340107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92102"
FT                   /db_xref="GOA:Q0SK34"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK34"
FT                   /protein_id="ABG92102.1"
FT                   /translation="MARSFAQSGVDIPLWHIDHSGSDIPQWNVIAEEGPMQYADNIRIS
FT                   DSEREQVVGELGRHLTEGRLTIGEFDQRVAQVYQSTTQQQAHQVLRDLPSAPQAVALAP
FT                   PRAPTAHPSRRRIPGHQRIEWLAWLAAGGINIAIWGIVSLATGVMIYPWPIWVIGPWGL
FT                   VLLGRTALGREGGCSRITDALHDDRTKVAVSR"
     atggcacggt ccttcgcgca gtcgggggtt gacattccac tgtggcatat cgatcatagt        60
     ggtagcgaca ttccacagtg gaatgtcatc gctgaggagg gtccgatgca gtacgcggac       120
     aacatccgga tatccgattc cgaacgcgag caggtcgtcg gagaactcgg acggcatctc       180
     accgaggggc gactgaccat cggcgagttc gaccagcggg tggcacaggt gtaccagtcg       240
     acgacccagc agcaggcgca tcaggtgttg cgtgatcttc cgtcggcacc ccaggcagtt       300
     gccctcgcgc cgcccagggc accgacggcc cacccgtcgc gtcgtcgcat cccgggtcac       360
     cagcggatcg agtggctcgc ctggctcgcc gccggaggaa tcaacatcgc gatctggggc       420
     atcgtttcgc tcgctaccgg cgtgatgatc tacccctggc cgatctgggt gatcggcccg       480
     tgggggttgg tgctgctggg caggacggcg ctcggccgcg agggcgggtg cagcaggatc       540
     accgatgcgc tgcacgacga ccggacgaaa gtcgccgtga gtcgctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page