(data stored in ACNUC7421 zone)

EMBL: CP000431.PE267

CP000431.PE267       Location/Qualifiers
FT   CDS_pept        340513..340839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK33"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92103.1"
FT                   /translation="MNAEPITCGDYVTATFARDFVAEGFDHDAVERIYSGLFDEWSHAL
FT                   AQSGLFTNRTVAAALHSWQDDPHSLLDALLANADEMTLKRYDLVWEALERSHVGSAEPL
FT                   AEYA"
     atgaatgcag aaccgattac ctgcggtgat tacgtcacgg caaccttcgc gcgtgatttc        60
     gtcgccgagg gattcgacca cgacgccgtc gaacgcatct acagcggtct gttcgacgag       120
     tggagtcacg cccttgctca atcgggtctg ttcaccaaca gaaccgtcgc ggccgcgctc       180
     cactcctggc aggacgaccc acactcgctc ctcgacgccc tgctcgcgaa cgcggacgag       240
     atgaccctca agcgctacga cctcgtctgg gaagctctgg agcgctccca cgtcggttcg       300
     gccgaacccc tcgccgaata cgcatga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page