(data stored in ACNUC7421 zone)

EMBL: CP000431.PE268

CP000431.PE268       Location/Qualifiers
FT   CDS_pept        341134..341385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK32"
FT                   /protein_id="ABG92104.1"
FT                   /translation="MNVQAMQVSTAPEGLGRYRDAVDALHAFDNPGHRTDPRTALLFDS
FT                   LTDDLIEAAQTAGAGDTVSQRDIVAVIDTAISRPRPSL"
     atgaacgtgc aagcgatgca ggtgagcacg gcgcccgagg ggctgggccg gtaccgcgac        60
     gcggtcgatg cgctgcacgc cttcgacaat cccggccacc gaaccgaccc tcgcacggcg       120
     ctgctgttcg acagcctcac cgatgatctg atcgaggcag cccagactgc gggagcgggc       180
     gacacggtgt cacagcgcga catcgtcgcc gtgatcgaca ccgcgatctc ccgcccgcgc       240
     ccctcactct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page