(data stored in ACNUC7421 zone)

EMBL: CP000431.PE269

CP000431.PE269       Location/Qualifiers
FT   CDS_pept        complement(341424..341837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00269"
FT                   /product="possible redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92105"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK31"
FT                   /protein_id="ABG92105.1"
FT                   /translation="MSSGVAEVSGHTVSGVPGRFILDARENHLVSDSRFGPAEAIQAGE
FT                   LLLAAIVSCAMANIQSNAEADDIRVEHIEVHASHRRGTADPTRYDFTEVRIEIHGVDQP
FT                   TADSLAARFESSCPIYNTIRRGSGIELTVTAHS"
     gtgagttccg gcgtcgcgga agtgtccggg cacacggtgt ccggggtgcc tggacgattc        60
     attctcgatg cccgcgagaa ccacctcgtc tcggattcga ggttcggccc ggccgaggca       120
     atccaggccg gtgaactgct cctggcagcg atcgtttcgt gcgcaatggc gaacatccag       180
     tccaacgccg aggccgacga catccgcgtc gagcacatcg aggtccacgc atcccatcgg       240
     cggggtacgg ccgacccgac tcgctacgac ttcaccgaag tgcgcatcga gattcacggg       300
     gtggaccagc cgacggccga ctcactggct gcgagattcg agtcgtcctg cccgatctac       360
     aacaccatca ggcggggaag tggaatcgag ttgaccgtca ctgcccactc ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page