(data stored in ACNUC7421 zone)

EMBL: CP000431.PE27

CP000431.PE27        Location/Qualifiers
FT   CDS_pept        complement(33810..34826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91863"
FT                   /db_xref="GOA:Q0SKS3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91863.1"
FT                   /translation="MNTRAVPTVPDRRTVESAVALACRAPSLHNSQPWRWVMGTALRLY
FT                   SDPDRLLPATDGFGRQMVISCGAALNHLEYAFTANHWRLVIERLPHSSDRQLLSTINFI
FT                   PAPAPTDFVARMAVAIGRRRTERLPMDPPPAWADTLEQLVRITAGTGVELEDLGQRSRP
FT                   ALEEASRRMTGLRHDDPTYQAELRWWSGRGLFPDGVPEQARPSDRQQHSVHLSREFPPG
FT                   RASTPDGGPSEDRAAILLLSTSADSRLDWLRSGEVLSAVLLACTDRGLGTCPVTHLTER
FT                   AVTRTLLRELSSGEGMPQVLIRVGAGTGVGEPSTTPRRPLSEVLVRERPAPGHLPGE"
     gtgaacacgc gcgcggtccc cacggtcccc gaccgacgta ccgtcgaatc agctgtcgcg        60
     ctggcgtgcc gcgcgccgtc actgcacaac agccaaccgt ggcgttgggt gatgggcact       120
     gccctgcggc tgtacagcga ccccgaccgg ctgctgcccg ccaccgatgg cttcggacgc       180
     caaatggtga tctcctgtgg tgcggccttg aatcacctcg agtacgcctt cacggccaat       240
     cattggcgtc ttgtgatcga acggctgccg cattcttccg accggcaact tctgtcgacg       300
     ataaacttca tcccggctcc ggcaccgaca gatttcgtcg cccgaatggc ggtggcgatc       360
     ggacggaggc gaaccgaacg actgcccatg gacccgccgc ccgcgtgggc ggacacactc       420
     gagcagttgg tgcgaatcac cgcaggtaca ggcgtcgaac tcgaagacct ggggcagcga       480
     agccgccccg cactcgagga agcatcacgc cgaatgaccg gtctacggca cgacgacccc       540
     acctaccaag ccgaactccg gtggtggtcg gggcgcgggc tgttccccga cggtgtgccg       600
     gagcaggctc gcccgtccga ccggcaacag cactcggtgc acctctcccg cgagtttcca       660
     cccggccgcg cgagcacacc cgacggcggc ccatcggaag atcgagccgc gatcctcctg       720
     ctctccacgt ccgcggattc gcgactcgat tggttacgga gcggcgaagt gctctccgcc       780
     gtcctgctcg catgcaccga ccgcggactc ggtacctgcc ccgtcaccca tctgaccgaa       840
     cgcgccgtga cgcggacact gcttcgagag ctgtcttccg gggagggaat gccgcaggtt       900
     ctgatcaggg tgggagcggg caccggcgtg ggggaaccct cgaccacacc cagacgcccg       960
     ttgtcggaag ttctggtgcg agagcggccg gctccgggcc acctgccggg ggagtag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page