(data stored in ACNUC7421 zone)

EMBL: CP000431.PE270

CP000431.PE270       Location/Qualifiers
FT   CDS_pept        complement(341834..343198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00270"
FT                   /product="probable dibenzothiophene desulfurziation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92106"
FT                   /db_xref="GOA:Q0SK30"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK30"
FT                   /protein_id="ABG92106.1"
FT                   /translation="MSPSRMHLAAFVTAGPGRPGGWRYPGSVPGWLSAGYYQNIARTLE
FT                   DARFDLVFFADILSVPDRFGGSPDSQLRNGALGSMRLDPLHVLSSMGAVTSHLGLAATV
FT                   STTYAQPFTVARSFATLDHLTEGRAAWNVVTSFQESEARNFNRDEQFPRDQRYERADEF
FT                   LEVAGKLWDSWEDDALVLDTEQPLFADPDRVHPIRHKGDWFTVQGPLNVPRPPQGYPVV
FT                   IQAGASAKGKDFAARWSDVIFCSHASLESAQDFYKEIKERAAAHGRDPESVKILPSIAP
FT                   VVGATTAIAQQTFEELFDLVPPLGGLSTLAYHLDVDLSTFPLDERLPDVEVPGVEGHYQ
FT                   EVREMTEREGLTLRELGKRYGGRVEGGFIGTATEVADGLGEWFGQGACDGFMVQAPYQP
FT                   GGFEDFTRHVVPELQKRGLFRKEYEGSNLRENLGLPRVQSGEWANRVRRGAEAAL"
     atgtctccct ctcgtatgca tctggccgcc ttcgtcaccg cgggccccgg tcggcccggc        60
     ggctggcggt acccgggatc ggttcccggc tggctcagcg ccggctacta ccagaacatc       120
     gcgcgcacgc tcgaagacgc acgtttcgat ctcgtgttct tcgccgatat cctctcggtg       180
     cccgaccgct tcggtggcag ccccgattcc cagctacgca acggtgcact cggctcgatg       240
     cgactcgacc cacttcacgt gctgtcatcg atgggtgcgg tcacgtcgca tctcggtctc       300
     gcagccacgg tctccaccac gtacgcgcaa ccgttcaccg tcgcgcggtc cttcgccacc       360
     ctggaccacc tgaccgaggg acgtgccgcc tggaacgtgg tgacctcctt ccaggagtcg       420
     gaagcgcgga acttcaaccg ggacgaacag tttccccgtg accagcgata cgagcgggcc       480
     gacgaattcc tcgaggtcgc agggaagctc tgggacagct gggaggacga cgctctcgtc       540
     ctcgataccg aacagccgct gttcgccgat ccggatcgag tacacccgat ccgtcacaag       600
     ggtgactggt tcaccgtgca ggggccgctc aatgtcccca ggcctccgca gggctacccg       660
     gtggtcatcc aggccggcgc gtccgcgaag ggaaaggact tcgccgcacg gtggtccgac       720
     gtgatcttct gcagtcacgc ctccctcgaa tccgcgcagg acttctacaa ggagatcaag       780
     gaacgggccg ccgctcacgg ccgcgacccc gaatctgtga agatcctccc gtccatcgcg       840
     cccgtcgtcg gggccacgac ggcgatcgcg cagcagacat tcgaagaact cttcgacctg       900
     gtaccgcccc tcggtggatt gtccacactc gcgtaccact tggacgtgga cctgtcgacg       960
     ttcccactcg acgagcgact ccccgacgtc gaggttcccg gcgtcgaagg ccactaccag      1020
     gaggtcaggg agatgaccga gcgggagggg ctgacgctgc gcgagctcgg gaagcgctac      1080
     ggcggtcgcg tcgaaggtgg attcatcggc actgcaacag aagtcgccga cggactcggg      1140
     gaatggttcg ggcagggggc ctgcgacggg ttcatggtgc aggctccgta ccagccggga      1200
     ggattcgagg acttcacccg tcacgtggtt cccgagctgc agaagcgagg actgttccgc      1260
     aaggagtacg aggggagcaa tctgcgcgag aacctcggac taccccgagt gcagagcggg      1320
     gagtgggcca accgggtgcg tcgaggcgcc gaggccgcac tgtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page