(data stored in ACNUC7421 zone)

EMBL: CP000431.PE272

CP000431.PE272       Location/Qualifiers
FT   CDS_pept        complement(344350..345087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00272"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="tc: 3.A.1.17; GO_component: GO:0019866 - organelle
FT                   inner membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_function: GO:0016887 - ATPase activity; GO_process:
FT                   GO:0006811 - ion transport; GO_process: GO:0006865 - amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92108"
FT                   /db_xref="GOA:Q0SK28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SK28"
FT                   /protein_id="ABG92108.1"
FT                   /translation="MPATNLVGLDLVGIGHRYRDTTVLHDIDLTVEPGEFVSFLGPSGV
FT                   GKSTLLRIIAGLEQPTHGVVESTGGTSGGTMSRMMFQEDRLLPWRNVLDNVQLGTRHQR
FT                   ERALELLYDVGLAGREKDWPSELSGGQRQRVALARALLHQPDVLLLDEPFGALDAITRV
FT                   AMQQLLERVLAEQPRTVLLVTHDVEEALVLSDRVLLLTDQGITRDLRIPHARPRHRGDA
FT                   QLAAWKEELLDGLLQADNALSSL"
     atgcctgcca ccaacctcgt cggcctcgat ctggtcggca tcgggcaccg ataccgtgac        60
     acgacggttc tccacgacat cgacctgacc gtcgagcccg gtgagttcgt ctcgttcctc       120
     ggccccagcg gggtcggcaa atccacgctt ctgcgaatca tcgccgggct cgaacaaccg       180
     acgcacggcg tcgtcgaatc caccggcggt acctcgggcg gaaccatgtc gcggatgatg       240
     ttccaggagg accgtctgct tccgtggcgc aacgtcctgg acaacgtgca gctcggaact       300
     cggcaccaac gcgagcgcgc actcgagctg ctgtacgatg taggcctggc cgggcgtgaa       360
     aaagattggc cgtcagagct ttccggaggg cagcgtcaac gcgttgcgct ggcacgggcg       420
     ttgctgcatc agcctgacgt cctcttgctc gacgagccgt tcggcgccct ggacgcgatc       480
     acccgcgtgg cgatgcagca acttctcgaa cgcgtcctcg ccgagcagcc gcggacggtt       540
     ctcttggtga cccacgacgt ggaagaggcg ctcgtgctct ccgatcgcgt gctgctcctc       600
     accgaccagg gcatcacccg cgatctgagg atcccgcacg cccgaccacg acaccgcggg       660
     gacgcccaac tcgcggcctg gaaggaggag ttgctcgacg gactcctcca ggcagacaac       720
     gccctctcgt ctctctag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page