(data stored in ACNUC7421 zone)

EMBL: CP000431.PE274

CP000431.PE274       Location/Qualifiers
FT   CDS_pept        346176..346799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00274"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92110"
FT                   /db_xref="GOA:Q0SK26"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK26"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92110.1"
FT                   /translation="MERESSAYKQLRERITGGADRPGTMLIPATIGAELGLSRTPVREA
FT                   LQRLEYEGLVVQAPRGYRVRERTPEEVLEICEARIALESAIAYSAATRHTELDLARLSR
FT                   LFEQAIESPDPATSLALHNEWHTALRSAAHNQTIAQLMDRLDAQLRVYDAEEAQASSNL
FT                   QQIETEHREILTAVQSGDAEKARILMIAHQARTRDLRIAAMARR"
     gtggagagag aatcatcggc gtacaagcag ctgcgtgagc gcatcaccgg cggcgccgac        60
     cggcccggga cgatgttgat cccggcgacc atcggcgcgg agttgggact gtcccgtacc       120
     ccggtgcggg aagcgttgca gcggctcgaa tacgagggcc tggtggtcca ggcgccgcga       180
     gggtaccggg tgcgcgagcg cacacccgag gaggtgctcg agatctgcga ggcacggatc       240
     gcgctcgagt ccgcgatcgc ctactccgcc gcgacccgcc acaccgaatt ggacctggcg       300
     cggttgagcc ggttgttcga gcaggcaatc gaatcacccg atcccgcgac gagcctggcg       360
     ctgcacaacg agtggcacac cgcgctgcgc agcgcggccc acaatcagac catcgcacag       420
     ctgatggacc ggctcgacgc tcagttgcgg gtctacgacg cggaggaagc ccaggcctcg       480
     tccaatctgc agcagatcga aacggaacac cgcgagatcc tgaccgccgt gcagagcggc       540
     gacgccgaga aggcgcggat cctgatgatc gcgcaccagg cgcggacccg cgatctgcgt       600
     atcgcagcaa tggcccgacg gtag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page