(data stored in ACNUC7421 zone)

EMBL: CP000431.PE275

CP000431.PE275       Location/Qualifiers
FT   CDS_pept        346902..347624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92111"
FT                   /db_xref="GOA:Q0SK25"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK25"
FT                   /protein_id="ABG92111.1"
FT                   /translation="MTNDRGEDPKSRPSPGMRRRLPWLLLAAVVVVVGAVAVVAYVLTS
FT                   GADDGREARDFSPSADNPDPSLGIEGIVTVDYPPADHVQALQRVAYDQSPPFGGAHDQY
FT                   WATCTGIVYPEAIRSENAVHSLEHGAVWVTYDPDRLDDDDIAALAANVEGEPYTLMSPY
FT                   PGLDSAVSLQSWGHQLKLDDVTDPRISDFLTALRQNPNTYPEPGATCSTVRGGFDPADP
FT                   PPFDPSAPGPDAVPVDGK"
     atgacgaacg accgcggtga ggacccgaaa tctcgaccgt ccccgggaat gcggcggcgc        60
     ctgccctggc tgctgctcgc cgccgtggtg gtcgtcgtgg gagcggtcgc cgtcgtcgcc       120
     tacgtgctga cctccggagc cgatgatggc cgcgaagccc gcgacttctc gccgagcgcg       180
     gacaatcccg acccgtcact gggaatcgaa gggatcgtca ccgtcgacta tccgcccgcc       240
     gaccatgtgc aggcactgca gcgagtggcc tacgaccaga gtcccccgtt cggcggtgcc       300
     cacgaccagt actgggcaac ctgcaccggc attgtctatc ccgaagcgat ccgtagcgag       360
     aacgccgtgc actccctcga acacggcgcc gtgtgggtga cctacgaccc ggaccggctg       420
     gacgacgacg acatcgcagc tctggcagcg aacgtcgagg gcgaaccgta caccctgatg       480
     tcgccgtacc ccggtctcga ctcggcggtg tccctgcagt cgtggggtca ccaactgaaa       540
     ctcgacgacg taaccgatcc gcggatctcc gatttcctca cggccttgcg acagaacccg       600
     aacacctacc cggaaccggg ggcaacctgc tcgacggtgc ggggcggatt cgatccggcc       660
     gacccgccgc cattcgatcc ttccgcaccg ggtccggacg ccgttccggt cgacggcaag       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page