(data stored in ACNUC7421 zone)

EMBL: CP000431.PE277

CP000431.PE277       Location/Qualifiers
FT   CDS_pept        complement(348985..349350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92113"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK23"
FT                   /protein_id="ABG92113.1"
FT                   /translation="MSNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRETLMFLTKEAV
FT                   RLALDGTIQGVACEGCPPLPDLAARFATAGGIYMVCPICFEAKHLDKDALVSNAELAGT
FT                   VPMWKWIGDEGAVTFSY"
     atgagcaata aagcagtggt cagtctcacc accggtctcg aggacgccga gaaggtgacg        60
     gttgcgtttc tggtcgcggt cggcgcggca gaacaacagc gcgagacgct gatgtttctc       120
     acgaaagaag cggtacggct ggcgctcgac ggcacgattc agggcgtggc ctgcgaaggt       180
     tgtccgccgc ttcccgatct ggcggcgcgg ttcgcgaccg cgggcggcat ctacatggtg       240
     tgtccgatct gcttcgaggc caagcacctc gacaaggacg cgctggtatc caatgccgaa       300
     ctcgccggga cggtgccgat gtggaagtgg atcggcgacg aaggggcggt gaccttcagc       360
     tattga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page