(data stored in ACNUC7421 zone)

EMBL: CP000431.PE278

CP000431.PE278       Location/Qualifiers
FT   CDS_pept        349515..350399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92114"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK22"
FT                   /protein_id="ABG92114.1"
FT                   /translation="MPLRLAVRHDRSTRASAAERIGIHPRMLTRMGAEPRQQARVSHGG
FT                   TTALFTLLPDTDVDEIDTIRITAGGCRRLGAAPGQTVTLDRRCTASAMTEEEAEMGGEF
FT                   IERLEDDGRHHRLVVLAPHGGAIETRTDQQAEQVVASLGSRDSTLWVCKGWRPVGNAYR
FT                   AWHISSTDLSVHSFPLLRSLSARRFRWALSFHGYRGNDVLIGGRAPARLKSDVRNAIAK
FT                   ALDGSGICVRVAERGERHSGESASNLVNRLTIDAAGGIQIEQSRAARTLHGPAIAAAVS
FT                   EVYDTWIAADNLR"
     atgccgttgc gcctcgcagt ccgtcacgat cgctccacca gggcatccgc cgccgaacgt        60
     atcggaattc acccgcggat gttgactcgg atgggagcgg agccgcgtca gcaggctcgc       120
     gtgagccacg ggggaacgac cgcactgttc actttgctcc cggataccga tgtggacgag       180
     atcgacacca tccggataac agcggggggc tgtcgtcgac tcggcgcggc gccgggacag       240
     acggtgacac tcgaccgacg gtgcaccgcc tccgcgatga ccgaggaaga ggccgaaatg       300
     gggggtgagt tcatcgagcg gctcgaagac gacgggcgac atcaccgtct cgtggtcctg       360
     gcaccgcacg gtggcgccat cgaaacccga acggatcagc aagctgaaca ggtcgtcgct       420
     tcgctcggat cacgcgattc gacactgtgg gtgtgtaaag ggtggcgacc ggtaggcaat       480
     gcctatcgtg catggcacat ttcctcgact gatctcagcg tgcacagctt tccgcttcta       540
     cgctccctgt cggcgagacg attccggtgg gcgctgtcgt ttcacggcta ccgaggaaac       600
     gacgtcctca tcggcggccg cgctcccgcg cggctcaagt cggacgtccg gaacgcgatc       660
     gcgaaggcac tcgacggaag cggtatctgt gttcgcgtag ccgaacgcgg agaacgacat       720
     agtggtgaat ccgcatccaa cctggtcaac cgcctgacca tcgacgctgc cggcggaatc       780
     caaatcgaac aatcacgagc cgcgcggaca ctgcacggtc cggcgatcgc tgcagcggtc       840
     agcgaggtct acgacacctg gatcgccgcc gacaatcttc ggtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page