(data stored in ACNUC7421 zone)

EMBL: CP000431.PE279

CP000431.PE279       Location/Qualifiers
FT   CDS_pept        complement(350404..351666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00279"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_function: GO:0004674 - protein serine/threonine
FT                   kinase activity; GO_function: GO:0004713 - protein-tyrosine
FT                   kinase activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0006468 - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92115"
FT                   /db_xref="GOA:Q0SK21"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK21"
FT                   /protein_id="ABG92115.1"
FT                   /translation="MQVGALFGRYRLDRSLTVDVSGEVWAAFDTVMFRQVVVRVLPPDA
FT                   TEDDEYCDRFEREAGIAAQIRNPHIVPIHDFGQVGNRLFLATPVTQGTNLRTILQSTGP
FT                   MEVSRAVGVVEQLASALEAVRVAGLVEQEVSSANVVVQDGGLVQLTDVGLPTILGAASG
FT                   VYGLTCVLYECLTGEVFPTSAIPTPPVGMAAVIARGTAADPARRYRSVGELAAAARVAA
FT                   PPQQPAVEPAPATPPIDRNRRLIVAGLALAAIVAVAIVGGVIIGSGTSSPHVAVPTPSS
FT                   SAARPASPSSSPSAMANPTAAEQEPPVQAPPPTETPVAEAPIQEEAIPTPAPQSPPVVP
FT                   APAPPPGASAPQVLPCYPGYEHTPPPDGPCLPPGSPPANAPAPVPAPAPAPAPAPQVLP
FT                   CYPGYQHTPPPDGPCWAPAGP"
     atgcaagttg gagcgctatt cggcagatac cggctggacc gttcgctgac ggtggatgtg        60
     agcggcgagg tctgggcggc gttcgacacc gtcatgttcc ggcaggtcgt ggtgcgggtg       120
     ctgccgccgg atgctaccga ggacgacgaa tactgcgatc ggttcgaacg ggaagccggg       180
     atcgcggcgc agatccggaa cccgcacata gtgccgatcc acgacttcgg gcaggtcgga       240
     aaccggctct ttctcgcaac gccggtcacc cagggcacga acttgcggac gatccttcag       300
     tccaccggac cgatggaggt atcgcgcgcg gtcggcgttg tcgagcaact ggcgtcggcg       360
     ctggaggccg tgcgcgtggc cgggctggtc gagcaggaag tgtcgtcggc gaacgtcgtc       420
     gtgcaggacg ggggactggt ccagctcacg gacgtcgggc tccccacgat tctcggggcc       480
     gcgtcgggcg tctacggtct gacctgcgtg ttgtacgagt gcctcaccgg ggaggtgttc       540
     ccgacctcgg cgatcccgac gccaccggtc ggcatggctg ccgtgatcgc acgcggaacg       600
     gcggctgacc ccgcgcggcg ctatcggtcg gtgggcgaac tcgccgccgc cgctcgtgtc       660
     gcggcgccac cgcaacagcc tgccgtcgag cccgctcctg cgacccctcc gatcgaccgg       720
     aaccgccgcc tgatcgtcgc cggacttgcg ctcgccgcga tcgtcgctgt cgcgattgtc       780
     gggggcgtga tcatcggatc gggaacgtca tcgcctcacg tcgccgtgcc tacgccgtcg       840
     tcgagcgcgg caaggccggc atcgccgtcg tcgtcaccgt ccgccatggc gaacccgacc       900
     gctgccgaac aggagccgcc ggtccaagca ccaccaccga cggaaacacc ggttgcggag       960
     gctcccattc aggaggaagc cataccgact ccggcgccgc aatcaccacc ggtagtgccg      1020
     gcacccgcac cccctccggg agcatccgct ccgcaggtgc tgccgtgcta tcccggttac      1080
     gagcacaccc cgcccccgga cggcccgtgc ctcccacccg gctcgccacc ggcgaatgcc      1140
     ccggcacccg tgcctgcccc ggcaccagcg cccgccccag ccccgcaggt gctgccgtgc      1200
     tatcccggtt accagcacac cccgcccccg gacgggccgt gctgggctcc cgcgggcccg      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page