(data stored in ACNUC7421 zone)

EMBL: CP000431.PE28

CP000431.PE28        Location/Qualifiers
FT   CDS_pept        complement(35002..35940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00028"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91864"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91864.1"
FT                   /translation="MTDARTRSLAPVVVGVDGSVAARGAARWAAAVADKQGATVHLIHV
FT                   LPSPPVFYTEPRPLPSEDEDRIAGERFLADAVRNIRSDRHTVAVECSLPTGSTAADVLL
FT                   PLADSASMVVIGSTARGPVEGYLNATALRLAHHSPCPVVVWRGAEEHAIPDRRAVVVGV
FT                   DGSRCSVAAVADAADFAGRFAAPLVAVHSWKSRVPPDAENAPDGAAARPRERAVLAESL
FT                   AGLADRYPDLAVREIVESGGAGEVLLRWCVDAQLLVVGNHGHGALGRAVLGSTSQDVLH
FT                   RARCPVMISKVQRDTGTVPDQAVEFGDRGHR"
     gtgaccgatg ccaggacacg gtctctcgcc ccggtcgtcg tcggagtcga cggctcggtg        60
     gcagcgagag gcgcggcgcg ctgggccgcc gcggtcgcgg acaagcaggg agcaaccgtg       120
     cacctgattc acgtgctgcc ctcacccccg gtcttctaca cggaaccccg gccacttccg       180
     tcggaagacg aggaccgcat cgccggggaa cggttcctgg ccgatgcggt acgcaacatc       240
     aggagcgacc ggcacaccgt cgccgtggag tgttcgctac ctaccgggtc gacggcggcg       300
     gacgtcctgt tgccgttggc ggattcggcg tcgatggtgg tgatcgggtc gacggcacgg       360
     ggccccgtgg aggggtatct gaacgctacg gcgctgcgac tcgcccatca ctcaccgtgc       420
     ccggtcgtgg tgtggcgggg agccgaagag cacgcgattc ccgaccgtcg cgcggttgtc       480
     gtcggtgtgg acggcagccg gtgcagtgtc gccgcggtgg ccgacgccgc cgacttcgcc       540
     gggcgattcg ccgcgccgct ggtggccgtg cactcgtgga agtcgcgtgt gccgcccgac       600
     gccgagaacg caccggatgg ggccgcggcc cgcccacggg agcgggcagt tctggcggag       660
     agcctcgcgg gactggccga tcgatacccc gacctcgccg tgcgagagat cgtcgagtcc       720
     ggtggagctg gcgaagtctt gctccgctgg tgtgtggacg ctcagcttct cgtcgtcgga       780
     aaccatgggc acggcgcact cggccgtgcg gtcctcgggt cgacgagtca ggacgtgctg       840
     caccgggctc ggtgcccggt catgatcagc aaagttcagc gtgacaccgg cacagtccct       900
     gatcaggccg tggagttcgg cgaccgtgga catcgctga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page