(data stored in ACNUC7421 zone)

EMBL: CP000431.PE280

CP000431.PE280       Location/Qualifiers
FT   CDS_pept        complement(351722..351988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92116"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK20"
FT                   /protein_id="ABG92116.1"
FT                   /translation="MLDPPDHVVQIPRCDVVGIPRLTDVCGPFGNPPTTDPVIEHGIEG
FT                   IAECSTHQVSPESGRSRTGTSLGAFCAYEHTTGLQREPMAPTA"
     gtgctggatc cgccagatca cgttgtacag attccacggt gcgacgtcgt aggtatccca        60
     cggctgaccg acgtgtgcgg tccattcggg aatccgccca caacagatcc ggtgatcgaa       120
     cacggaatag agggcattgc agaatgcagt acgcatcagg tttctcctga gtcggggcgg       180
     tcccggaccg ggactagcct aggtgcgttc tgcgcatacg agcacactac cgggctccaa       240
     cgagaaccta tggcccccac cgcctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page