(data stored in ACNUC7421 zone)

EMBL: CP000431.PE281

CP000431.PE281       Location/Qualifiers
FT   CDS_pept        complement(352088..353200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92117"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK19"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92117.1"
FT                   /translation="MSDTIRMFLAGDVMTGRGVDQILPFPGDPELRERCVRDARGYVAL
FT                   AEKRNGPIPGPVGFGWPWGEALPILDAAEPEARVVNLETTVTTCARFASKGINYRMHPS
FT                   NLGVLTAARIDVCVLANNHLLDFGADGLVETLDVLARNGVRTVGAGRTVAQAWCPVVVE
FT                   TGRGRRLLIWAAALPSSGVSSHGAARRGRPGVAYLPEPTPAEADNVLDRTRLIRRNTDV
FT                   VAVSLHWGSNWGYDVPDAHVEFAHRLVDGGVDVVFGHSSHHPRPVEIYRGHPILYGCGD
FT                   LINDYEGIGGHERFRDDLRLLYLVTLDARTHELLELRMVPMRSRQMQLHRASRRDTEWL
FT                   RRVLDGISRDFGTRIDVGDDVLVARANHAN"
     atgtccgaca ccatcaggat gttcctcgcc ggcgacgtga tgaccggtag gggcgtcgac        60
     cagatcctcc cctttcccgg cgacccggag ttgagggagc gttgcgtccg cgatgcccgc       120
     gggtacgtcg cgttggcgga gaagcgaaat ggtccgatcc ccggccccgt cgggttcggg       180
     tggccgtggg gtgaggcgtt gccgatcctc gacgctgcgg agcccgaggc ccgcgtcgtc       240
     aatctcgaaa cgaccgtcac cacgtgtgct cgattcgcgt ccaagggaat caactacaga       300
     atgcatccgt cgaacctggg ggtgctcacc gctgcgcgga tcgacgtctg cgtactggcg       360
     aacaatcacc tactcgactt cggtgccgat ggtctcgtgg agaccctcga cgtgctggcg       420
     cgcaacggcg tgcggaccgt cggagcgggg cgcaccgtgg cacaggcgtg gtgtcccgtg       480
     gtcgtggaga ccggacgggg tcgtcggctg ctgatctggg ccgcagcact gccgtcgagt       540
     ggggtctcgt cgcacggggc ggcacgccgg ggtcggccgg gtgtcgcgta ccttccggaa       600
     cccacgcccg ccgaggcaga caatgtcctc gaccggacgc ggctgatacg gaggaacacg       660
     gacgtggtgg cggtctctct gcactggggt tcgaactggg gatacgacgt gccggacgcg       720
     catgtcgaat tcgcgcatcg gctcgtcgac ggtggtgtcg atgttgtctt cgggcactcg       780
     tctcaccacc cgcggccggt cgagatctac cgcggccacc cgatcttgta cggctgcggc       840
     gacctgatca acgactacga gggcatcggg ggacacgaac gcttccgcga cgatctgcgg       900
     ctgctctatc tggtgacgct cgacgcgcgc acgcacgaac tgctcgagct acgaatggtg       960
     ccgatgaggt ctcggcagat gcaactgcac cgcgcgtcga gacgtgacac cgaatggctg      1020
     cggcgggttc tcgacgggat cagccgcgac ttcggcaccc gcatcgatgt aggcgacgac      1080
     gttctcgtcg cccgcgcgaa ccacgcgaac taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page