(data stored in ACNUC7421 zone)

EMBL: CP000431.PE282

CP000431.PE282       Location/Qualifiers
FT   CDS_pept        complement(353287..353679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92118"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK18"
FT                   /protein_id="ABG92118.1"
FT                   /translation="MKVTAKATRCGGWWVVEVPGVEAALTQARRLDQVSAMVADAVHLV
FT                   EDVPAEDVEVVLDYEIGDSAALMEARAAQLQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILELSPQRVSQLDRADARTR"
     atgaaggtga cggcgaaggc cacccgttgt ggcggctggt gggtggtgga ggtcccggga        60
     gtcgaggcgg ctctcaccca ggcgcggcgg ctcgatcagg tttctgccat ggtggcggat       120
     gctgtgcatc tggtcgagga tgtgccggcc gaggacgtcg aggtggtcct cgactacgag       180
     atcggggatt cggcggcgct catggaggcc cgagcggccc agttgcaggt cgagtccgcc       240
     gctcacgcgc aggaatgtgc agcgcgggcc tcgcgggccg cggtggcgca tctgcgccga       300
     tcggggctgt cggtgcgtga tatcggtgtc atcctcgagc tgagcccgca acgggtctct       360
     cagctcgacc gagcagacgc tcgtactcga tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page