(data stored in ACNUC7421 zone)

EMBL: CP000431.PE283

CP000431.PE283       Location/Qualifiers
FT   CDS_pept        complement(353828..356866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00283"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent; GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0042829 - defense response
FT                   to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92119"
FT                   /db_xref="GOA:Q0SK17"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK17"
FT                   /protein_id="ABG92119.1"
FT                   /translation="MADFDPDATQAAAVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDPENRERFLREGYAMGGLSGHPNIVNILQVGVTDAGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTA
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISSQPVPDLRAQGIPDGVCAVIERAMATNPAARPGSAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEAAQTTEEHPSDSGADGYRRIRYEGSDSGQRPWGE
FT                   PTQQLQPDSHPSGPPFWPPNGPPPWPPTGESGSIGESRTGRRAVLTVLALVVALVLAGG
FT                   GYLVLRETTGPGTARPTVQDAGASPAVDPTAAWRPVEDARVARQQTATTVADGTIWVFG
FT                   GLDENGVSAQQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWKAEGQNLTAV
FT                   DSDRVMAMRDGRWVDLPPLNAPRAAGAAAVVGDKIVVAGGQANGQLVATTEVFDGTKWT
FT                   TVAPVPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAGTWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEEPTRVLSTVEAYDVVAGTWSQLPALRTPRHGMAVGAVGNTVY
FT                   AVGGGIKPTHAESTAVSEALQLAPRKTQWAPAWRPLEDAPIARQQTATAVADGTIWVLG
FT                   GLDNAGSTPKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGI
FT                   TSDRVLALRNGKWMDLAPMNEPRAAGAAAVVGDKIVVAGGQADGALVATTEVFDGTKWT
FT                   TVSDIPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAATWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEQPTKVLSTVEAYDVDSGTWSSLPPMPTGAHGMSVATVGHTAY
FT                   AIGGALRPTHAESTATAQALDFW"
     atggccgatt tcgacccaga tgcgacccag gcggcggcgg tccgtgcagt cggccacggg        60
     atcgtggccg agttggacgc tgccgggttc gcaggtgccg aggaagtcgg ccggggcggg       120
     ttcggtgtcg tgtaccgctg cctgcagcgt tcactggggc gaatcgtcgc gatcaaggtg       180
     ctgacctcgg acctggaccc cgagaaccgc gaacgcttcc tgcgggaggg gtacgcgatg       240
     ggtgggctct ccggtcaccc gaacatcgtc aacatactgc aggttggcgt gaccgacgcc       300
     ggtcgcccgt acatcgtcat gcactatcac ccccgcgatt cactggcggt ccagatacgc       360
     cgggaaggtc cgctgccctg gccggaggcg atcagcatcg gggtgaagct ggcgggagcc       420
     ctggagacgg cgcaccgcac cggtacgctg catcgcgaca tcaaacccgc gaacatcctg       480
     ctcaccgcct acggcgagcc gcagctcacc gatttcggca tcgcgcacat cgccggcggg       540
     tacgaaacgg ccaccggcgg gtttaccggg tcactggcat tcaccgcgcc ggaggtgctg       600
     aacggggaat cgccgaccgc gaggtccgac gtctacggac tgggcgcgac gatcttttca       660
     ctgatcgcgg ggagggcggc gttcgagcgg aagaccgggg aggaactcgt tgcgcaattc       720
     gtgaggatca gcagccaacc ggtgccggac ctgcgcgccc agggcatccc ggacggcgtg       780
     tgcgccgtga tcgagagggc aatggcgacg aatcccgctg ctcggccggg gtccgccgag       840
     gagttcggac acgaactcca agccgctcag cgacacatcg gtctgcgttc ggacgcgatg       900
     gcgctggcac ccctggaggc cgcgcagacg actgaggagc acccgtcgga ttccggtgcc       960
     gatggatacc gtcgaatccg ctacgaaggt tcggacagcg gtcagcgtcc gtggggcgaa      1020
     ccgacccagc agctccagcc ggattcccat ccgtcgggac cgccgttctg gccgccgaat      1080
     ggcccgccgc cctggccacc gaccggagaa tcgggcagca tcggagagtc ccgcacaggt      1140
     cggcgcgcgg tcctgaccgt cctggcactg gtcgtcgcgc tggtgctggc cggcggcggg      1200
     tacctcgtgc ttcgagaaac caccggccca ggcaccgcac gacctaccgt gcaggacgcc      1260
     ggcgcttctc ctgccgtcga cccgaccgcg gcgtggcgac cggtcgagga tgcccgtgtt      1320
     gcccgccagc agacggcaac gaccgtcgcg gacgggacga tctgggtctt cggagggttg      1380
     gacgagaacg gcgtctccgc ccagcaggag ggctatgacc cggccatcga cacctggaag      1440
     gccggccccg accttccggt cccgctcaat catgcgatgg ctgtcaccta caacgacgaa      1500
     cccgtgctga tcggcggttg gaaagcggaa ggtcagaacc tgaccgctgt cgattccgat      1560
     cgggtgatgg ccatgcgcga cggccggtgg gtggacctgc cgccgctgaa cgcaccgcgg      1620
     gcagctgggg ccgcggccgt ggtcggcgac aagatcgtgg tcgcgggcgg acaggcgaac      1680
     ggtcaactgg tggcgacgac cgaggtgttc gacggcacga agtggacgac cgtcgcgcct      1740
     gtccccacac cacgcgagca cctggccggg gtgtcggatg gtacgtactt ctatgcgatc      1800
     ggtgggcggg atctggcgtc ggaccagaac accgccgcgg tcgaacggtt cgatcctgcc      1860
     gcgggaacgt ggacgacgtt gcccgccatg cccactcctc gcggtgggct cggtgcggcg      1920
     ttcatcgacg gccgcatcgt cgcggtcggt ggtgaagaac cgactcgggt gctgtcgacc      1980
     gtggaggcct acgacgtggt cgcgggaacg tggtcgcaac tgccagctct gcgcacaccg      2040
     cggcacggga tggcggtcgg cgcggtcggc aacacggtgt atgccgtcgg cggcggtatc      2100
     aaaccgacac acgccgaatc cactgctgtg tccgaggccc tccagctcgc gccacgcaag      2160
     acccagtggg cgccggcgtg gcgtccgctg gaggatgcgc cgatcgcccg tcagcagacg      2220
     gcgacggccg tcgcggacgg cacgatctgg gtgctcggcg gactcgacaa tgcggggtcg      2280
     accccgaagg tcgaggggaa cgaccccgcc atcgacacct ggaaggcggg ccccgacctt      2340
     ccggttcccc tcaatcacgc gatggccgtc gagtacgggg gcgagttggt ggtcctcgga      2400
     ggctgggtgc cggaaggtcc gaacctcacc gggatcacgt cggaccgggt gctcgcgctg      2460
     cggaacggca agtggatgga tttggcgccg atgaacgagc cgcgggcggc gggggccgcg      2520
     gccgtggtcg gcgacaagat cgtggtcgcc gggggacagg cggacggcgc attggtggcg      2580
     acgaccgagg tgttcgacgg aacgaagtgg acgaccgtct cggacatccc gactccacgg      2640
     gagcatctgg ccggggtgtc ggatggtacg tacttctatg cgatcggtgg gcgggatctg      2700
     gcgtcggacc agaacaccgc cgcggtcgaa cggttcgatc ccgccgcggc aacgtggacg      2760
     acgttgcccg ccatgcccac tcctcgcggt gggctcggtg cggcgttcat cgacggccgc      2820
     atcgtcgcgg tcggtggtga acagccgacc aaggtgctgt cgaccgtcga ggcctacgac      2880
     gtcgactcgg gaacctggtc atcattaccg cccatgccca cgggagctca cgggatgtcg      2940
     gttgcaacgg tcggtcacac cgcctacgcc atcggcggtg cgttacggcc cacccatgcg      3000
     gagtccaccg cgactgcaca ggcactggat ttctggtga                             3039
//

If you have problems or comments...

PBIL Back to PBIL home page