(data stored in ACNUC7421 zone)

EMBL: CP000431.PE284

CP000431.PE284       Location/Qualifiers
FT   CDS_pept        complement(357214..357504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00284"
FT                   /product="probable conserved signalling protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_function: GO:0005554 - molecular function
FT                   unknown; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92120"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK16"
FT                   /protein_id="ABG92120.1"
FT                   /translation="MRPGDTVARLGGDEFVVVCEDVAGAPEAGAIAARITGSLADLNRA
FT                   ESLDWPISASIGVALSDPECTREELVRRADSATYRAKAAGPGGYALYDGTF"
     gtgcgcccgg gcgacaccgt tgcccgcctc ggcggtgacg aattcgtggt ggtgtgtgag        60
     gacgtcgcag gtgcaccgga ggcgggggca attgccgccc ggatcacggg aagcctcgcc       120
     gacctgaacc gggccgaatc tctcgactgg ccgatcagtg ccagtatcgg tgtcgcactg       180
     tccgatccgg agtgcacccg cgaagaactc gtccgccggg cggactcggc gacgtatcgg       240
     gcgaaagctg cggggccggg cggctacgcg ctctacgacg gcaccttcta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page