(data stored in ACNUC7421 zone)

EMBL: CP000431.PE285

CP000431.PE285       Location/Qualifiers
FT   CDS_pept        357816..358304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK15"
FT                   /protein_id="ABG92121.1"
FT                   /translation="MGMRRVRWPAFAPPAASGTAVHGPTILASKTHITLDLLGIIAFSS
FT                   GIHVRLALTATGRAAERAHHETRTLSDPTDPDTQWSYLSVLLQLGSVAGEADPYLPRSG
FT                   SPLKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCVTALLEPSPSAVTSD"
     gtgggcatgc gcagagtgcg ttggccggca ttcgcgccgc cggcagccag tgggaccgca        60
     gtgcacggtc ccaccattct cgcgtccaaa acgcacatca ccctcgactt gctgggaatc       120
     atcgctttct cgtccggaat ccatgtccgg ctcgcgctga ccgcgaccgg gcgcgccgcc       180
     gaacgtgcgc atcacgagac acgaacgctg tccgatccga ccgatcccga cacccagtgg       240
     tcgtatttgt cggtgctact gcagctgggt tccgtggcgg gcgaagccga cccctacctt       300
     ccgcgctccg gctcgccgct gaagtggggt ggggtgcctg cgtaccgcac ggagccgaat       360
     tattggctcg gaacgtgtac acgcccgcac gacatcatga tctcggcggg gtggccggag       420
     atcggtctcg gtccgacctg tgtcacggcc ctcctcgaac ccagcccgtc cgctgtcaca       480
     tccgattga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page