(data stored in ACNUC7421 zone)

EMBL: CP000431.PE287

CP000431.PE287       Location/Qualifiers
FT   CDS_pept        complement(358630..359907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00287"
FT                   /product="probable signal transduction histidine kinase in
FT                   2 component regulatory system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92123"
FT                   /db_xref="GOA:Q0SK13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK13"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92123.1"
FT                   /translation="MAESSVLPADLGGSPDLERIILEHAYRGAYLQLALRGVLVLFIAL
FT                   TLAFVPPMNDAGVCVAVLICYALWSGGLALWTRRGGPGPVNAMWLALFGDLAVLGCLTL
FT                   LTGIAAQQSWTADILSNGLFVIPLLASTQLRPGVCASVVVPTVLIFLAASWATMASNEE
FT                   PWSSILLSTMALAVLGAGAVMLSRIQRSRVLTIGHLVRDRTALLAELMGLEQRERRALS
FT                   EQLHDGALQFVLAAKMDLDDLTGSADPEAVGRITHALTESATLLRATVSELHPTVLDRV
FT                   GLARALGDLTRSAQARGGFEVQLLTSEWVDDLRTSADDVLFSAARELLSNVVKHAQAGT
FT                   VRVELARWGEHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGSFSVHPGP
FT                   RSGTVAHIEMPFEIVTAPDSLTTSAH"
     atggctgagt catcggtact acccgcggat ctcggcggca gcccagatct cgaacgcatc        60
     atcctcgagc acgcctatcg cggcgcgtat ctccagctcg cacttcgtgg tgttctggtg       120
     ctcttcatcg cgttgacgct ggcgttcgtc ccgcccatga acgacgcggg cgtgtgcgtc       180
     gcggtcctga tctgctacgc actatggtcc ggcgggctcg cgctgtggac tcggcgaggc       240
     ggtcccgggc cggtgaatgc gatgtggctc gccctgttcg gcgacctcgc ggtcctcggt       300
     tgcctcactc tgttgactgg tattgcggca caacagagtt ggaccgcaga cattctgagc       360
     aacggtttgt tcgtgatccc gctgctggcc tccacgcagc tgcgcccggg ggtctgtgcg       420
     tccgtggtcg tgccgacggt cctgatattc ctggccgcga gctgggcgac gatggcgtcg       480
     aacgaagagc cctggtcctc catcctgctc agcacgatgg ccctcgccgt cctcggtgcg       540
     ggcgccgtga tgctcagcag aattcaacgg tccagggtgc tgacgatcgg tcacctggtg       600
     cgcgaccgta ccgccctgct cgcggagttg atgggtctcg aacaacgcga acgacgtgcg       660
     ttgtcagagc aactccacga cggggcgctc caattcgtcc tggccgcgaa gatggacctc       720
     gacgacctca ccggcagtgc cgaccccgag gcggtcggtc gcatcaccca cgcactcacc       780
     gaatccgcaa ccctgctcag ggcgaccgtc tccgagctgc atcccactgt gctcgatcgc       840
     gtcggtctcg ctcgcgccct cggcgatctc acccgctcgg cccaggcacg tggcggtttc       900
     gaggttcagc tcctgacctc ggaatgggtc gacgaccttc gcacgtcggc tgatgatgtg       960
     ctgttcagcg cggcacgcga attgctcagc aacgtggtca aacacgcgca agccggtacc      1020
     gttcgggtcg agctggcgcg gtggggtgag catgccgtcc tcgatgtcac cgacgacggg      1080
     tgcggcatct cccgagaggc gatcgaccgc agcctcagca gaggccacat cggattgaca      1140
     tcgcacgaac tccgtgtcgt cgcggcggga ggcagcttct ccgtccaccc cggacctcga      1200
     tccggaacgg ttgcgcacat cgaaatgccg ttcgagatcg tgacagcacc cgattccctc      1260
     accacctcgg cgcactag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page