(data stored in ACNUC7421 zone)

EMBL: CP000431.PE288

CP000431.PE288       Location/Qualifiers
FT   CDS_pept        complement(359989..361254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92124"
FT                   /db_xref="GOA:Q0SK12"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK12"
FT                   /protein_id="ABG92124.1"
FT                   /translation="MVPNPDPCEDRSRVPRTVRTRGRHPVSLRAQSATALVTAALAVAV
FT                   VASVDWQLCRGVFSPTELALFVIVGVVFVSAGLVAKWHRPQDNLGWLLVFAGLLWLVKG
FT                   FRLSTVPALFTAGAALTNMYIPVLIQLVFSFPWGRLRHRWERWFVGGSYAYYAVAVVSE
FT                   LAFLDTHRVSPAHPPSLNLLLVRDDPRVFAALQVIFGAVGIALGVVLIGVVVARWRSGS
FT                   PAYRAAVAPLWIAALLGTAATAWTPLVSVWVHSPQHAWTLLLRYPSTALIPLAVLAGMW
FT                   RYRVARAAVRNLMIEIGTAPLGDGFIEALRAALRDPDLALWSFSRARDGYVDAQGRPQV
FT                   LPPRNDPREATALIRDGVLVGALVYDRAVADLPRLLAAVRAATTLALDNQRLHGELEAQ
FT                   FAEVRRARELTAECQGSYTRRC"
     atggtgccga atccggatcc ctgcgaggat cgatcccgtg ttcctcgaac tgtccggact        60
     cgcgggcggc acccggtgag tcttcgcgcg cagagtgcga ccgccttggt gaccgccgca       120
     ctggctgtcg cggtggtggc atccgtcgac tggcagttgt gccggggcgt gttcagtccg       180
     acggaattgg cgttgttcgt gatcgtcgga gtggtgttcg tgtcggccgg cctggtcgcc       240
     aagtggcacc ggccgcagga caacctgggg tggctgctgg ttttcgccgg gctgctgtgg       300
     ctggtgaagg gctttcggct gtcgacggtc ccggccctgt tcacggccgg cgcggcgctg       360
     accaacatgt atatcccggt actgatccaa ctcgtgttca gttttccctg ggggcggttg       420
     cgtcaccggt gggagcgatg gttcgtcggc ggaagttatg cgtattacgc ggtcgccgtc       480
     gtctccgagc ttgcattcct cgacacccac cgcgtcagcc cggcccatcc gccgtcgttg       540
     aacctgctcc tggtgcgtga cgacccgagg gtcttcgcgg cgctgcaagt gatcttcggt       600
     gcggtcggga tcgccctcgg tgtcgttctg atcggggtgg tggtcgcccg gtggaggtcg       660
     ggttcaccgg cctaccgggc cgccgtggcg ccactgtgga ttgccgcgct gctcgggacc       720
     gccgccaccg cctggacacc gctggtctcc gtgtgggtgc acagcccgca gcatgcgtgg       780
     acgctgcttc tgcgctatcc gtcgactgcg ctgatcccgc ttgcggtgct ggccgggatg       840
     tggcgctacc gagtcgcccg agccgcggtg cgcaacctga tgatcgagat cggtaccgct       900
     ccactcggtg acggcttcat cgaagcgctg cgggcggcgt tacgcgaccc ggacctggcg       960
     ttgtggtcgt tctcccgcgc ccgcgacggg tatgtggacg cgcaggggcg tccccaggtt      1020
     ctgccaccga ggaacgatcc ccgcgaggcc actgccctca tccgtgacgg cgtcctggtg      1080
     ggggcgttgg tgtacgaccg ggcggtcgcc gacctgccga ggctgctggc ggccgtgcgg      1140
     gccgcgacca ccctggcgct ggacaatcag cgactgcacg gcgaactcga ggcgcagttc      1200
     gccgaggtcc gcagggcccg cgagctgacc gccgagtgcc aggggtcata cactcgccgg      1260
     tgctag                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page