(data stored in ACNUC7421 zone)

EMBL: CP000431.PE289

CP000431.PE289       Location/Qualifiers
FT   CDS_pept        361424..362338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92125"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK11"
FT                   /protein_id="ABG92125.1"
FT                   /translation="MTRIRLRPAVALASIAGVSSLFLAACTQDASSTEGTESAAPSASS
FT                   EAPPTEAPVNGVDAKEYASSDAEADSYGFVTPSGKWLCAIIPTKNLAGCVSHPTAGPLG
FT                   VPGTPQIASPDGGPLAEANLIAVEAGKEPSFQNWNQAVFPGNANVLPYDTTLAIDGFSC
FT                   NVQFSGVSCREDATDKGFTISTSGYAFEFTPLPVSLPSASPPQIAPTPAPLPQQARGSN
FT                   QCGPVVYPETGKPATVVIVKGTLRCDEAHTMLTKYFAAPDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCSDDNGNTVVAQP"
     atgaccagga ttcgacttcg gcccgcggtg gcgctggcat cgatcgccgg tgtctcgtcc        60
     ctgtttctcg cggcctgcac ccaggacgca tcgtcgaccg agggcaccga atcggccgcg       120
     ccgagtgcct ccagcgaggc accgccaacg gaggcaccgg tcaacggtgt cgatgcgaag       180
     gagtacgcct ccagcgacgc agaagccgat tcctacggct tcgtcactcc gtcagggaaa       240
     tggctgtgcg cgatcattcc cacgaagaat ctggccggat gcgtctctca tcccacagcg       300
     gggccattgg gagtgccggg gactccacag atcgcctcgc cggacggcgg cccgctggcg       360
     gaggcgaacc tcatcgcggt cgaggcgggg aaggagccga gcttccagaa ctggaaccag       420
     gctgtctttc ccggcaacgc caacgtcctt ccctatgaca ccacgctggc gatcgacgga       480
     ttcagttgca atgtgcagtt ctccggcgtc tcctgcaggg aggatgcgac ggacaaggga       540
     ttcaccatct ccaccagcgg ctacgcgttc gagttcaccc cgttacccgt gagcctcccc       600
     agcgcgagcc caccgcagat cgcgcccacc ccggccccgc tcccccagca ggcccgcgga       660
     tcgaatcagt gtggccccgt tgtctatccg gagacgggta aacctgcgac cgtggtcatc       720
     gtgaagggca cactccgctg cgacgaggcg cacacgatgc tcacgaagta cttcgcggca       780
     ccggacaaga gcgaaccggt gtacagcttc gacgggtggg aatgccgcct cgcgggagac       840
     ccggaatccg cggagatcgg ttacacgatc aactgctccg acgacaacgg gaacaccgtg       900
     gtcgcccagc cgtag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page