(data stored in ACNUC7421 zone)

EMBL: CP000431.PE290

CP000431.PE290       Location/Qualifiers
FT   CDS_pept        362405..362722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK10"
FT                   /protein_id="ABG92126.1"
FT                   /translation="MHPPNDQAGTWEGSWLAAMTVIKSAQRVFTPENRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLIEWACQPDQPSEIREFGATLAFLSMKLT
FT                   T"
     atgcacccac cgaatgacca ggcaggtacc tgggaaggtt cgtggctcgc ggcgatgacg        60
     gtgatcaaga gcgctcagcg ggttttcacg cctgagaacc gccctccctc cgagctgatc       120
     cctctcgtcg aacccctgag ccggttgggt gatgcgctcc gggcaacacc gcccgacccc       180
     gaagaatccc gccgtcgcgc cgccgacctg gtggccgatc gagacctgat cgaatgggca       240
     tgtcagccgg accagcccag cgagatccga gagttcgggg cgaccttggc cttcctgtcc       300
     atgaaactga ccacctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page