(data stored in ACNUC7421 zone)

EMBL: CP000431.PE292

CP000431.PE292       Location/Qualifiers
FT   CDS_pept        363832..365406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92128"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK08"
FT                   /protein_id="ABG92128.1"
FT                   /translation="MRIARMRPGSAQRGVVTAALAVSVVLGVATSPMPAIASAETFFFD
FT                   DVGSTAVPRANCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLVGGLQDRGGGLLS
FT                   VTYDHCSYTSTFFPGNLLNPTTPGVQVLDVSNPAQPALSTTLNEPAMLGGTWESLKVNK
FT                   ARKLLAATAVPIAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFISHEGGFSPDGN
FT                   TYWVSGPAPGFLTAIDIRNPAEPRIIWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLD
FT                   ISAVQRGDPYPTVPQIATYLWTDGFFNQHSIPVTYGDKPYIFTVDETGGGGIKVFDVAD
FT                   PAHAEIVQKIKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPADPTALACSWESSG
FT                   IRVFDVRDLSRISEIAYYNPPAQTGKNVQLTNSPHALSSLIGVSLFNFVPLARAVFEGK
FT                   TDPRVAFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFIALQLDDAVYQPPVN
FT                   QVSTYGQ"
     atgaggatcg cgcggatgcg accaggaagt gcccagcgag gtgtggttac cgcggccctc        60
     gcggtatcgg tcgttctcgg cgtcgcgaca agcccgatgc ctgccatcgc gtcagccgag       120
     acgttcttct tcgacgacgt cggttcgacg gccgttccgc gggcgaactg cggtcctggt       180
     tcgctgccgg agaccggtat gcagggcgac gttccggccg aggaccggaa caacggccgt       240
     agcacccagg gctatcgatg caacatgtcg ctggtcggag gcttgcagga tcgcggtggc       300
     ggcctgctgt ccgtgaccta cgaccactgc tcctacacca gcacgttctt ccccgggaac       360
     ctgctcaacc ccacaacgcc gggcgtacag gtgctcgacg tgtcgaaccc cgcgcagccg       420
     gcgttgtcca cgaccctgaa cgaaccggcg atgctgggcg gaacctggga aagtctgaag       480
     gtcaacaagg cacgcaagtt gctcgcggcc acagcggtgc cgatcgctgc cggcacgggc       540
     tacttctccg tctacgacat ttccgactgc gcccaccccc ggttgctcaa ccggggtgcc       600
     ggtaccgacg tcaccatgcc gctgccgttc atctcccacg aaggcggctt ctccccggac       660
     ggcaacacct actgggtgtc cggccccgca ccgggattcc tcaccgccat cgacatcaga       720
     aatccggccg agccgcggat catctggcag ggattgcacg gactcggcgg acatggattc       780
     ggcatcaccc cggacgggaa ccggatgtac ctgtcgaatc tcggtgggat caccgtcctc       840
     gacatcagcg cggtgcaacg aggcgaccca tatcccaccg tcccgcagat cgccacctat       900
     ctgtggaccg acggcttctt caatcagcac agcatcccgg tcacatatgg ggacaagccc       960
     tacatcttca ccgtcgacga aaccggcggc ggtgggatca aggtcttcga tgtcgccgac      1020
     ccggcgcacg ccgagatcgt gcagaagatc aagctcgaga tccagctccc ggccaatacc      1080
     gccgcgaacc ttcggtcgtc gcaaggcggc tcggtgttct cctacgatcc gcactactgc      1140
     gtggtcgacc gcccagccga cccgaccgcg ctcgcgtgct cctgggaatc gtccgggatc      1200
     cgcgtgttcg atgttcgcga tctgagccgc ataagcgaga tcgcctacta caacccgccg      1260
     gcacagaccg gtaagaacgt tcagctcacc aactcaccgc acgcactgtc ctcgctgatc      1320
     ggtgtctcac tcttcaattt cgttccgctc gcccgcgccg tcttcgaggg caagacggat      1380
     ccgcgggtcg cgttcggccc gcgcgccgga atggtggcgt tcggcgacct gtccgcggac      1440
     tggtgcttct cgcctccgga gttccacggc aaccagatct ggacctcgtg cagcgacaat      1500
     ggtttcattg cgttgcagct cgacgacgcc gtttatcaac caccggtgaa tcaggtttcg      1560
     acctatgggc agtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page