(data stored in ACNUC7421 zone)

EMBL: CP000431.PE293

CP000431.PE293       Location/Qualifiers
FT   CDS_pept        365396..366049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00293"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92129"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK07"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92129.1"
FT                   /translation="MGSDTTPSSFRRPLVLLLCAVLVGAAGVAAGMWLQSERATNPGGV
FT                   QLSSADIGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVSQTSEIAAMRGWLNL
FT                   FDEPFTTPHPMQWIQGSDHAMGDQGGAPMPGAASISEITRLAGLRGSDAETLFLQLMIR
FT                   HHQGGVDMAEAATDVVASEPIRRIARGMIRDQSNEIAVMTAILDTRNARPLPHP"
     atgggcagtg acaccacgcc ttcgtcgttc cgccgtccgc tcgtcctgtt gctgtgcgcc        60
     gtcttggtcg gtgccgccgg ggtcgccgcc ggaatgtggc tgcagtctga gcgcgccacg       120
     aaccccggcg gggtccaatt gtcatcagcg gacatcggtt tcgcacagga catgtcggtg       180
     caccacgagc aggccgtcct gatcgcccag acgctgccgc gggacgtcga tccgcagatc       240
     cgggtcatcg ccgaccagat cgtcgtctca cagacctccg agatcgcggc gatgcgcggc       300
     tggctcaacc tcttcgacga gccgttcacc accccgcatc cgatgcagtg gatccaagga       360
     tccgatcacg ccatgggtga ccagggcggc gcgcccatgc cgggagcagc gagtatcagc       420
     gagatcaccc ggctcgccgg cctgcgcggc tcagacgccg agacactgtt tctgcagctc       480
     atgattcggc accaccaagg gggcgtcgac atggccgagg ccgccaccga cgtggttgca       540
     tccgaaccga tccgccgcat cgcacgcggg atgatccgtg accagagcaa tgaaatcgca       600
     gtaatgactg ccatactcga cacccgaaac gcgagaccgc tccctcaccc gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page