(data stored in ACNUC7421 zone)

EMBL: CP000431.PE294

CP000431.PE294       Location/Qualifiers
FT   CDS_pept        366327..367085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00294"
FT                   /product="probable 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0016616 - oxidoreductase activity,
FT                   acting on the CH-OH group of donors, NAD or NADP as
FT                   acceptor; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92130"
FT                   /db_xref="GOA:Q0SK06"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK06"
FT                   /protein_id="ABG92130.1"
FT                   /translation="MTTETTPVSIQREPELAGQTVVVIGGSAGIGLETARRARAEGAEV
FT                   ILTGRNSDRLAQAATEVGTRRTAAFDANDTASLARFFHDLPTPIDHVLVTAGGPRYAPL
FT                   LEMDSDEVREQLSGHVVLGLEVARNAASKMRPGGTLILMGGTGGRRIGHGLGIASAATA
FT                   ALPPFTAALALELAPVRVNLIAAGFVDTPLSASLLGDRLDERRNELRTTLPIGRVVGPA
FT                   DVAALAVHIMSNTALTGATYDIDGGQQFVS"
     atgaccaccg aaaccactcc agtctccatc cagcgcgaac cggaactggc cggacaaacc        60
     gtcgtcgtga tcggcggcag cgcaggcatc gggctcgaaa cagctcgacg cgcccgggcc       120
     gagggcgccg aggtcatcct caccggccgc aattctgacc ggctcgccca agcagcgaca       180
     gaggtcggca cgcgacgcac cgcggccttc gacgccaacg acacggcctc cttggccagg       240
     ttcttccacg acctgccgac accgatcgac catgtgttgg tcacggccgg gggcccacgc       300
     tacgcgcccc tgctcgagat ggactccgat gaggtgcgcg aacaactcag cggtcacgtg       360
     gtgctggggc tcgaggtcgc gcgcaacgcg gcgagcaaga tgaggcccgg cggcacgctg       420
     atactcatgg gcggaaccgg cgggcggcgc atcggtcacg gactggggat cgcctccgcc       480
     gccaccgcgg cactgccccc gttcacggcg gccctcgcgc tcgagctcgc gccggttcgc       540
     gtcaacctca tcgccgccgg cttcgtcgac accccactgt cggcatcgct gctcggagat       600
     cgactggacg agcgaaggaa cgaattgcgg acaacgcttc cgatcggccg ggtcgtcggc       660
     cccgccgacg tcgccgcact ggccgtccac atcatgagca acaccgcgct caccggcgcg       720
     acatacgaca tcgacggtgg gcagcagttc gtctcgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page