(data stored in ACNUC7421 zone)

EMBL: CP000431.PE295

CP000431.PE295       Location/Qualifiers
FT   CDS_pept        367161..367793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00295"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016829 - lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92131"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK05"
FT                   /protein_id="ABG92131.1"
FT                   /translation="MSTNEVQTNDSTRTHVAPVDMKLEVVVIPVTDVDRATEFYTRLGW
FT                   RQDVTPPGSGVVQFTPPGADASIHFGADLTTAAPGSAKGYLIVSDIEAARDQLVAADIE
FT                   VTLFHLGPDGPGDGLDPDRRSYFSLASFSDPDGNAWVLQEVTTRLPGRIDTAVTSFGSA
FT                   RDLAAALRRAAAAHGGHEERTGEEDPNWPDWYAEYMAAEQSGAELPT"
     gtgagcacaa acgaagttca gaccaacgat tcgacccgca cgcatgtcgc gccggtcgac        60
     atgaagctgg aggtcgtcgt cattcctgtc acggacgtcg accgggccac cgagttctac       120
     accaggctcg gttggagaca agacgtcaca ccgccgggct ccggcgtcgt ccagttcacc       180
     ccgcccggtg ctgacgcctc gatccacttc ggcgccgacc tcaccacggc cgcacccggt       240
     tccgccaagg gatacctcat cgtctccgac atcgaggctg cccgtgacca gctggtcgcc       300
     gccgacatcg aggtgaccct gttccacctc ggcccggacg gcccgggtga cgggctggac       360
     ccggaccgtc gcagctactt ctcgctggcg tcgttcagcg accccgacgg caacgcctgg       420
     gtgctgcagg aggtcaccac caggcttccc gggcgtatcg acaccgccgt cacctcgttc       480
     ggctctgcac gcgacctcgc ggcggcgctc cggcgcgcgg cggccgccca cggcgggcac       540
     gaagagcgca ccggcgaaga agacccgaac tggcccgatt ggtacgccga gtacatggcc       600
     gccgaacagt ccggggcgga gctacccacc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page