(data stored in ACNUC7421 zone)

EMBL: CP000431.PE296

CP000431.PE296       Location/Qualifiers
FT   CDS_pept        368207..368617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92132"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK04"
FT                   /protein_id="ABG92132.1"
FT                   /translation="MEQGPQRTVGRRCPAPTTGSSPTDGPDFGGTYAPPWRAEYAAEAT
FT                   QRGKETATRISGRSILQIYFFDTDSSAESGIAAYNGPNPLPEPAAHSVVEVHLTPNYER
FT                   GTQWFVGLGTDYPQFQVTALTEPARIAVDIHD"
     gtggagcagg gtccccagcg cacagtcggg cggaggtgcc ccgccccaac gaccggatcc        60
     tcccccaccg acggacccga cttcggcggc acttacgcgc cgccctggcg cgccgaatac       120
     gccgccgagg caacacaacg cggcaaggag accgcgacac gaatcagcgg tcgatcgatc       180
     ctgcagatct atttcttcga cacggactcc tcggccgaga gcgggatcgc tgcgtacaac       240
     ggaccgaacc cgttgccgga gcccgcggcg cacagcgtcg tggaggtaca cctcacaccg       300
     aactacgaaa gggggaccca gtggttcgtc ggcctcggta ccgactaccc gcagttccag       360
     gtcacggcac tcacggaacc ggcgaggatc gccgtcgaca tccacgacta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page