(data stored in ACNUC7421 zone)

EMBL: CP000431.PE297

CP000431.PE297       Location/Qualifiers
FT   CDS_pept        368769..369269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00297"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003676 - nucleic acid binding;
FT                   GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92133"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK03"
FT                   /protein_id="ABG92133.1"
FT                   /translation="MRDNRPAASALQLYRAFQHQHPRTPVPADYVTECGFRLGRWQDRQ
FT                   RIARMLGTLPPQRIEQLDAIGFLWSDDDVPLPAVSRTDAKRRRMLTAIAAYREEHGNAL
FT                   VPANYVTADGEQVGQWLYRAVKKWRADALPDKERRTLSVLGVSPGPRPRGPRTSAHLVG
FT                   QVM"
     atgcgagata acaggcccgc agcctcagcc ctgcagctct accgcgcttt tcagcaccag        60
     cacccccgaa ctccggtccc tgccgactac gtcaccgaat gcggtttccg actgggacgt       120
     tggcaggacc gccagcgcat tgcccgcatg ctcggcacac tgccgcccca gcgcatcgag       180
     caactcgacg cgatcgggtt tctgtggagc gatgacgacg tcccacttcc ggccgtgtca       240
     cgtaccgacg ccaagcggag acggatgctc accgccatcg ccgcctaccg cgaagagcac       300
     ggcaacgcac ttgttcccgc gaactatgtc accgcagacg gtgaacaggt gggccagtgg       360
     ctctaccggg cggtgaagaa gtggagggcc gacgcgttgc cggacaaaga gcgtcgcaca       420
     ctctccgtcc tcggggtgtc ccccggtcca cgaccacgag gaccccggac atcagcacac       480
     ctcgtcggac aggtgatgtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page