(data stored in ACNUC7421 zone)

EMBL: CP000431.PE298

CP000431.PE298       Location/Qualifiers
FT   CDS_pept        369410..370369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00298"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92134"
FT                   /db_xref="GOA:Q0SK02"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK02"
FT                   /protein_id="ABG92134.1"
FT                   /translation="MDVPHRVGVLVFDGVKMLDVAGPSEVFTEANRLGATYELVLCSVG
FT                   AVDVTASTGMRISVDVDAANTGRLSTALVMGGDLFPSTPVSPELAGAATTLAGNADRMA
FT                   SICTGAFILAAAGLLDGRRATTHWQHADTLARGYPRITVEPDAIFVEDGTIFSSAGVTA
FT                   GVDLALAFVERDHGTELARAVAQSLVVFLQRPGGQSQFSPSLRGPRPRTGQLREVVDAV
FT                   AADPTGDHSITRLAARANVSPRHLTRLFQDELGTTPAKYVELIRFDTAKAMLDAGHTVT
FT                   STAQHSGFGSPETLRRSFIQHLGVSPRAYRQQFHSTRR"
     atggatgtgc cccaccgtgt cggtgtgctc gtgttcgacg gcgtgaagat gctcgacgtc        60
     gccggtccat ccgaggtctt cacggaggcc aatcgactcg gcgccacgta tgagttggtg       120
     ttgtgctcgg tcggggcagt cgacgtgacc gcgtccaccg ggatgcggat ttccgtcgat       180
     gtcgatgccg caaacacagg tcgtctgtcg accgcgctgg tgatgggtgg cgaccttttt       240
     ccgtcgacgc cggtgagccc ggaactcgcc ggtgcggcca ccacgctggc cggcaacgcc       300
     gaccggatgg cctcgatctg cactggtgcg ttcatcctgg cggcggccgg gctcctcgac       360
     ggtcggcgcg cgaccaccca ctggcagcac gccgataccc tcgcgcgcgg atatccccgg       420
     atcaccgtgg aacccgacgc catcttcgtc gaggacggca ccatcttctc ctcggcaggt       480
     gtcaccgccg gcgtcgactt ggccctggct ttcgtcgaac gcgatcacgg caccgaactg       540
     gcacgagcgg tcgcccagtc actcgtggtg ttcctgcagc gaccgggcgg tcagtcccag       600
     ttctccccca gcctgcgcgg gccgcggcca cgcaccggac agctccgcga ggtggtcgat       660
     gccgtagccg cggatcccac cggtgaccac tccatcaccc ggctcgccgc gcgcgccaac       720
     gtcagtcctc ggcatctgac caggctgttc caggacgagc tggggaccac cccggccaag       780
     tacgttgagc tgatccgatt cgacaccgcc aaagccatgc tcgatgcagg acacaccgtg       840
     acttccacgg cgcagcacag cggattcggc agcccggaga ccttgcgacg cagtttcatc       900
     cagcatctcg gggtgtcgcc gcgggcgtat cggcagcaat tccactccac ccgtcgctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page