(data stored in ACNUC7421 zone)

EMBL: CP000431.PE299

CP000431.PE299       Location/Qualifiers
FT   CDS_pept        370504..371142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00299"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92135"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK01"
FT                   /protein_id="ABG92135.1"
FT                   /translation="MTDTVAGIEIPDTVVVNEATELVREAANPLIYHHSRRVFLFGSLR
FT                   ARHQKLAFDPELLYVGAMFHDLGLTAKYRRADQRFEIDGADEARTFLRSHGIGEDDADT
FT                   VWTSIALHTTPEIPLHMAPEIALLTRGVELDVLGIGYDAITDEERAAVVASHPRPDFKN
FT                   EILAAFTDGLEDRPDTTFGNVKADVLAHFVPGFVRGDFVDVILNSAWSE"
     atgaccgaca ccgtcgcagg catcgagatt cccgacaccg tcgtggtcaa cgaggcaacg        60
     gaactggtgc gggaggccgc gaacccgttg atctaccacc actcccggcg tgtgttcctg       120
     ttcggctcac tccgagcccg acatcagaag ctcgcgttcg atcccgagct gttgtacgtc       180
     ggggccatgt tccacgacct cggcctcacg gcgaagtacc gccgcgcgga tcagcgattc       240
     gagatcgacg gcgccgacga ggcccgcacc ttcctccgct cccacggaat cggcgaagac       300
     gatgcagaca cggtgtggac gagcatcgca ctccacacca cccccgagat tccactgcat       360
     atggcaccgg agatcgcgct gcttacccgc ggcgtcgaac tcgacgtact cggtatcggc       420
     tacgacgcga tcaccgacga ggaacgtgcc gccgtcgttg cctcccaccc gcggccggac       480
     ttcaagaacg agatcctcgc cgccttcacg gacggactcg aagaccgccc ggacaccacg       540
     ttcggcaacg tgaaggccga tgtgctggca cacttcgttc ccggcttcgt ccggggtgac       600
     ttcgtcgatg tgatcctgaa ttccgcttgg tcggaatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page