(data stored in ACNUC7421 zone)

EMBL: CP000431.PE3

CP000431.PE3         Location/Qualifiers
FT   CDS_pept        4147..5319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91839"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S091"
FT                   /protein_id="ABG91839.1"
FT                   /translation="MALLVRVRTRPGPTAPGGHGRGTAPGNVAAHRLDHRVLAVDACAC
FT                   GWIWRRSSTRGAHRALRRRLHALPATGIAPQLPPPKPRCARAELAARALLVSRTDMPTL
FT                   RCCTKFAHHCGSPDPTASAPRKLSASDPAPVAEPAIRSGAAFIPVACRRRTMGELVDRP
FT                   DVVERSDQEAPMPRPSSWVRTTASALGEELARIGLTVPADRLEDLLTDRVAAVAERMHI
FT                   TERTARRYFDPHALRTLARELALRINDEAPGADLLTLPRTIAMPLPTLGATIAALVEVA
FT                   ALAGADTGPDEPATAMSMISTLGVLTREHDGHLPTVWVPEPLLVRAVRLIENTADLVHH
FT                   GCTLPPGVAEDVRPHLRKALSDDAARLRALTPHTGRRTGPGLWAVPDDPR"
     atggcactac tcgtccgggt caggactcga ccgggaccca ccgctccagg cgggcatggc        60
     aggggaactg ccccggggaa cgtcgccgcg catcgactcg atcaccgtgt cctcgccgtc       120
     gacgcatgcg cgtgcggatg gatctggcgg agatcgtcga ccagaggcgc tcaccgagca       180
     ctacgccgcc gactgcatgc cctgcccgcc accggaatcg ctccacagct cccccctccg       240
     aagccgaggt gtgcacgggc agagttggcg gcaagagcgc ttctggtgtc gaggacagac       300
     atgcccaccc ttcgttgttg caccaaattt gcacaccact gtggaagtcc cgatccgaca       360
     gcgagcgcac cccggaaact gtcagcgtcc gatccagcac ccgtcgccga acccgcaatc       420
     cggtccggcg cggcgttcat tcccgtcgcc tgccgccgcc gcaccatggg cgaactggta       480
     gacagaccag atgtggtgga acgctctgat caggaggccc cgatgccacg accatcatca       540
     tgggtgagga cgacggcctc cgccctcggt gaggagctgg cacggatcgg tctgaccgtc       600
     cccgccgacc gactcgagga cctgctcacc gaccgagtcg ccgccgtggc agagcggatg       660
     cacatcaccg aacgcaccgc ccgccggtac ttcgatcctc acgcactgcg caccctcgcc       720
     cgtgaactgg ccctgcgcat caacgatgag gcacccggcg ccgacctgct gacactgccc       780
     cgcaccatcg ccatgcccct gcccaccctc ggtgcgacaa tcgccgccct cgtcgaggtc       840
     gccgccctcg ccggcgccga caccggtccc gacgagccgg cgacagcgat gtcgatgatc       900
     tccaccctcg gcgtcctgac cagagaacac gacggtcacc ttcccactgt ctgggtgccg       960
     gagccactcc tcgtgcgagc ggtgcggctc atcgagaaca ccgccgacct cgtgcaccac      1020
     ggctgcacac tcccaccagg cgtcgccgag gacgtacgcc cccacctgcg gaaggcactg      1080
     agcgacgacg ccgcccggct acgggcactg accccccaca ccggccgacg gaccggcccg      1140
     ggcctgtggg cggttcccga cgatccccgg tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page