(data stored in ACNUC7421 zone)

EMBL: CP000431.PE30

CP000431.PE30        Location/Qualifiers
FT   CDS_pept        complement(36733..37650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00030"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="tc: 3.A.1; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0015087 - cobalt ion transporter activity; GO_function:
FT                   GO:0016887 - ATPase activity; GO_process: GO:0006824 -
FT                   cobalt ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91866"
FT                   /db_xref="GOA:Q0SKS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS0"
FT                   /protein_id="ABG91866.1"
FT                   /translation="MSDTIAMCTVGLSKRFGSVLALDAVDLNVVEGEVFGYLGPNGAGK
FT                   STTLRLLTGLLRPTAGSARVLGLDAWSAAPAVHRRIGYVPGELALYDRLTGRQHITFFG
FT                   HLRGDPVDKAATVFADRLDLDLDLDRTARTMSKGNRQKLALVLALMSGPQLLILDEPTG
FT                   GLDPLVQHEFHAIIREHTASGGTVLLSSHVLGEVQQVADRVGVLREGRLIAVESLHELR
FT                   QKSLHHVTAECSTPIQESDFRDVAGIRGLTVAGTSLTCSAPQSALDALIRRISHYGIVD
FT                   FECAEADLEETFMAFYEIRDRHAA"
     atgtccgaca ctatcgccat gtgcacggtg ggactgagca agcggttcgg ttcggtactc        60
     gctctggacg cggtggactt gaatgtcgtc gaaggcgaag tcttcggcta cctcggcccc       120
     aacggtgccg gaaagtcgac cacgctccgc ttactcacgg gcttgctgcg tcccactgcg       180
     gggtcggccc gtgtgctcgg cctcgatgca tggtcggcgg cacccgcggt tcatcgtcgg       240
     atcggctacg tccccggcga attggctctc tacgaccgcc tgaccggacg gcagcacatc       300
     acgttcttcg gacacctgcg tggcgaccct gtcgacaaag ccgcgaccgt gttcgccgat       360
     cgactcgatc tcgatctcga tctcgatcgc accgcccgga cgatgtcgaa gggaaaccgc       420
     cagaagctcg cgctggttct cgccctgatg tccggcccgc aactgctgat tctcgacgaa       480
     ccgaccggcg gactggatcc gctcgtgcaa cacgagtttc acgcgatcat ccgggagcac       540
     accgcatccg gcggaacggt cctgttgtcg tcccacgtac tcggcgaagt gcagcaggta       600
     gccgaccgcg tcggtgtgct gcgggagggt cgcctcatcg ccgtcgagag tcttcacgaa       660
     ctacgccaga agtcgctgca ccatgtcacc gccgaatgtt cgaccccgat ccaggaatcg       720
     gacttccgcg acgtggccgg tatccgcggc ctcaccgttg cgggcacatc gctgacgtgc       780
     agtgcgcctc agtccgcgct ggacgccttg atccgccgga tctcgcacta cggcatcgtc       840
     gacttcgagt gcgccgaggc cgacctcgag gagaccttta tggcgttcta cgagattcga       900
     gaccgacatg ctgcgtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page