(data stored in ACNUC7421 zone)

EMBL: CP000431.PE300

CP000431.PE300       Location/Qualifiers
FT   CDS_pept        complement(371159..372382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00300"
FT                   /product="MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92136"
FT                   /db_xref="GOA:Q0SK00"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK00"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABG92136.1"
FT                   /translation="MAIAPHESTDAIAHELAGWAVGIEPGAGDLDLARRALVDTIAVTL
FT                   AALDDPAAAWTDGLPAALRWAAVGHVLDFDDLHIPSTTHISVVCVPATLSAGGGGREYL
FT                   AAAGVMARLGTALGWNHYTQGWHTTATVGAISAAVAAGLSFGLDSEGIATAMAHAVPAA
FT                   GGVRQAFGTAGKSIQVGFAAQAGVRAAGLAAAGATADPRAVGEWFRLVGGRMSPHVEGP
FT                   IIPDGLGLKLHPCCYALQRPIAAVRSLGSLSVDDIARIRVHTPNSAVLPLIHNFPSSGL
FT                   EGKFSLNYGIAAALLDGFPDIGSFTDPAVQRPEVRSILDRVSLVAEPVGEGVLDGDCTV
FT                   VVELRDGSQLEAVVDLPVGHPRRPASVADFEAKVRGCVGDERAAEILNLDWVSAAALLQ
FT                   RHLPGGGN"
     atggcgattg cgccgcacga atcaaccgat gccatcgcgc acgaactcgc agggtgggcc        60
     gtcggtatcg agccaggcgc cggggatctc gatctcgctc gacgtgctct ggtcgacacc       120
     attgcagtaa cccttgccgc actggatgat ccggcagctg cgtggacgga tggtctgccg       180
     gctgcgctgc gctgggcagc ggtcgggcac gtgctcgatt tcgacgatct gcacataccc       240
     tccacgaccc acatcagtgt ggtgtgcgtt cccgccacgt tgtcggcggg cggcggtggg       300
     cgggagtacc tggctgcggc gggggtgatg gcacgtctgg gtaccgcgct cggttggaac       360
     cactacacac aggggtggca caccaccgcg acggtcggtg ccatctcggc tgctgtcgcg       420
     gcggggctgt cgttcgggct cgattccgag ggtatcgcta ctgcgatggc gcacgccgtc       480
     cccgccgcag gtggcgtccg ccaggccttc ggcaccgcag gcaagtcgat tcaggtcgga       540
     ttcgctgccc aggctggtgt gcgtgcggcc ggactcgccg ctgccggcgc gactgccgac       600
     cctcgtgctg tcggtgaatg gttccggctc gtcggcgggc ggatgtcccc gcacgtcgaa       660
     ggtcccatca ttccggatgg tctcgggctg aagcttcacc cgtgttgcta cgcgctccag       720
     cgtccaatcg cggcggttcg gtcgcttggg tcgttatcgg tcgacgacat cgcccgcata       780
     cgggtgcaca ctccgaacag cgcggttttg ccgttgatac acaactttcc gagttcgggt       840
     ctggaaggta agttctcgct gaactacggc atcgcggcag ccctgctgga cgggttcccc       900
     gatatcggga gcttcaccga ccctgctgtg cagcggccgg aagtgcggag cattctcgac       960
     cgcgtcagtc tggtcgccga gcccgtgggc gagggggtgc tcgatggaga ctgcacggta      1020
     gtcgtcgaac tccgcgacgg atcacaactc gaggccgtgg tcgacctgcc tgtggggcat      1080
     ccgcgccggc ctgcatccgt cgcagatttc gaagccaaag ttcgagggtg tgtcggtgat      1140
     gaacgggcgg ccgagatact gaacctggac tgggtttcgg cagcggcatt gttgcaacgt      1200
     catctgccgg gcggtggcaa ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page