(data stored in ACNUC7421 zone)

EMBL: CP000431.PE31

CP000431.PE31        Location/Qualifiers
FT   CDS_pept        37808..38821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91867"
FT                   /db_xref="GOA:Q0SKR9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR9"
FT                   /protein_id="ABG91867.1"
FT                   /translation="MRSTEEAIVDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYADG
FT                   QLDLYTERGRLLASTDPSGRQLVVSCGAALNHLETALTGLKWSVDIRRVPEGPHSGHLA
FT                   TIRFRHDARPQSHDFDLLAAIRHRYSDRRPFGPVSMKTPLPPALTDVTRRVDVHLTLLA
FT                   QDARPTLAKATELTAAARKYDSAYQAELHWWAGHSIPQGGIPADSLATAENRDRVDIGR
FT                   RFPAGRDNDASPGIDRSTVLVLSTDTDGREAWLRAGEALSAVLLEATVGGLATCPLTHM
FT                   TELRQSREMIRELVPDRGFPQALIRVGTTEKKSPPRQTPRRPVESVFSIGRRHSTR"
     gtgcgatcta ccgaggaggc gatcgtggac agcaccattc ccgacgagaa cgtcgtgcgc        60
     attgccgtgg acctcgcctg ccgggcaccg tcggtgcaca acagtcagcc gtggcagtgg       120
     acgtacgccg acggtcagct cgacctttac accgaacgcg gtcggcttct ggcctcgaca       180
     gacccgtcgg gccggcagct ggtcgtcagt tgtggtgcgg cgctgaatca tctcgaaacg       240
     gcattgaccg ggctcaaatg gtcggtggac atccggcgcg tcccggaggg gcctcactcg       300
     gggcatctgg cgacgattcg gttccgccac gacgcccggc ctcagtcgca cgacttcgac       360
     ttgcttgccg cgatccggca ccggtattcc gaccgcaggc ccttcggtcc ggtcagcatg       420
     aagaccccgc tgcccccggc attgaccgac gtgacgcgtc gcgtggacgt ccacctgacc       480
     ctgctggcac aggacgctcg tccgaccctg gcgaaggcga cggagttgac cgcggccgca       540
     cgaaaatacg attccgcgta ccaggccgag cttcactggt gggcgggtca ttctattccg       600
     cagggtggga taccggcgga ttccctcgcg accgcggaga atcgtgaccg cgtcgacatc       660
     ggacgccgtt tccccgccgg ccgcgacaac gacgcgagcc cggggatcga ccgctcgacg       720
     gttctcgtgt tgagcaccga taccgacggt cgtgaagcgt ggctccgggc cggtgaggcc       780
     ttgtccgcgg tgctgttgga ggccaccgtc ggcggtctcg cgacgtgccc gctgacgcac       840
     atgaccgaac tacggcagag ccgggagatg atccgcgaac tggttcccga ccgcggcttc       900
     ccgcaggccc tgatccgggt gggcacgact gagaagaagt ctccgccacg tcagactccc       960
     cggcgccccg tcgagtcggt gttctcgatc ggccgccgcc actccactcg ttga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page