(data stored in ACNUC7421 zone)

EMBL: CP000431.PE32

CP000431.PE32        Location/Qualifiers
FT   CDS_pept        complement(38846..39313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00032"
FT                   /product="hydrogenase maturation protease"
FT                   /note="GO_component: GO:0009375 - ferredoxin hydrogenase
FT                   complex; GO_function: GO:0004222 - metalloendopeptidase
FT                   activity; GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0016485 - protein processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91868"
FT                   /db_xref="GOA:Q0SKR8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR8"
FT                   /protein_id="ABG91868.1"
FT                   /translation="MTVVVIGLGNELRRDDGIGPAVARQVADRVAPDVRVSVSDGDPAA
FT                   LLDAWAGAQLAVLVDAVVCEPSRPGTVHRFTPDELAGVRAGRFSTHGISLGDIIQLGTV
FT                   LDRLPHRMVVLAVEVADLAAGGGLSPAVGRAVETAVAAVLSVLGEPLAEMS"
     atgacggtcg tggtgatcgg gctgggaaac gaactccgcc gcgacgacgg gatcggtccg        60
     gcggtcgcgc gacaggtcgc ggaccgcgtc gccccggacg tgcgcgtgtc cgtgtccgac       120
     ggggacccgg ccgctctgct cgacgcgtgg gccggtgcgc agctggccgt cctggtcgac       180
     gccgtcgtct gcgaaccgtc gcgacccggc accgtgcacc ggttcacacc ggacgaactc       240
     gccggggttc gggcgggcag gttcagcacc cacgggatct ccctcggcga catcattcaa       300
     ctcggcaccg tgctcgatcg gctgccgcac cgaatggtcg tcctcgccgt cgaggtcgcc       360
     gacctggctg ccggcggcgg actgtcaccc gcggtcggcc gcgccgtcga gacggcggtg       420
     gcggcggtac tgtcggtgct cggtgagccg ctcgcggaaa tgtcgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page