(data stored in ACNUC7421 zone)

EMBL: CP000431.PE33

CP000431.PE33        Location/Qualifiers
FT   CDS_pept        complement(39310..40578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00033"
FT                   /product="Ni-dependent hydrogenase large subunit"
FT                   /note="GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0016151 - nickel ion binding;
FT                   GO_function: GO:0047806 - cytochrome-c3 hydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91869"
FT                   /db_xref="GOA:Q0SKR7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR7"
FT                   /protein_id="ABG91869.1"
FT                   /translation="MVRALARVEGEGRVDVTVREGRAEHVTLDIYEPPRFFESFLRDRH
FT                   FLEPPDITSRICGICPVAYQVSACNAIEQACGLELDDDVRDLRRLLYCGEWIASHVLHI
FT                   YFLHAPDFLGLPDSIALARHDREAVERGLSLKKAGNAILDAIGGRPIHPVNVRIGGFHR
FT                   APTAAELIPLSDQLRTALDHAVATVRWVSSFDFPDIELDHDLLALHDDSRYAIEDGEIR
FT                   SSTGLRCTADEFPKHVVEHQVPHSTALHAELDGRRYLTGPLARYSLNSSRLGGVAARTA
FT                   ADAGLGAQCRNPYRSIVVRAVEVVYAVEEALRIIDRYERPPQPFTAGSPIRTVGHGVSE
FT                   APRGLLYHRYEVDPAGLIRAATIVPPTSQNQAAIEHDLRRAVDGNLMLADDELTTLCER
FT                   TIRNYDPCISCATHFLTLTVDRR"
     atggtgcgcg ccctcgccag ggtcgagggt gagggccgcg tcgacgtgac cgtgcgggag        60
     gggagagcag aacacgtcac actcgacatc tacgagccgc cccgcttctt cgaatccttc       120
     ctccgtgacc gccactttct cgaacccccg gacatcacct cgcgaatctg cggtatctgc       180
     ccggtggcct atcaggtgag cgcgtgcaac gccatcgagc aggcatgcgg actcgagctc       240
     gacgacgacg tgagggatct gcggcgactg ctgtactgcg gcgagtggat tgccagtcac       300
     gtgctgcaca tctacttcct gcacgcaccc gactttctgg ggctcccgga ttcgattgcc       360
     ctcgcccggc acgatcggga ggccgtcgag cggggcctgt cgttgaagaa ggccggaaac       420
     gcgatcctcg acgcgatcgg tggcaggccg atccacccgg tcaacgtccg tatcggcgga       480
     ttccaccggg cgccgaccgc agccgaactg atacccctgt ccgaccaact gcgcacggca       540
     ctcgatcacg cggtggcaac cgtccgatgg gtgtcgtcgt tcgacttccc cgacatcgaa       600
     ctcgaccacg acctcctcgc actgcacgac gactcccgct acgccatcga ggacggcgag       660
     atccggtcgt cgaccggatt acgttgcacc gccgacgaat tcccgaagca tgtggtagag       720
     caccaggtgc cgcactcgac cgcactgcac gccgagctcg acggccgccg atacctcacc       780
     ggaccgctgg ctcggtactc gctcaattcg tcccggctcg gcggagtggc cgcccggacc       840
     gccgccgacg ccgggctggg cgcgcagtgc cggaacccgt accgcagcat cgtcgtccgc       900
     gccgtcgagg tggtctacgc cgtcgaggaa gcattgcgca tcatcgaccg atacgagcgg       960
     cctccgcagc cgttcaccgc cgggtcaccg atacgtacgg tcggacacgg agtcagcgag      1020
     gcaccccgcg gactgctgta tcaccgttac gaagtcgatc ccgccgggct gatccgcgcc      1080
     gccaccatcg ttccgccgac gtcgcagaac caggccgcca tcgaacacga cctacggcgc      1140
     gcggtggacg gaaacctcat gctggccgac gacgaactga cgacgctgtg cgaacgaacc      1200
     atccgcaact acgatccgtg catctcgtgc gccacccact ttctgacgct cacggtcgac      1260
     cgccgatga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page