(data stored in ACNUC7421 zone)

EMBL: CP000431.PE36

CP000431.PE36        Location/Qualifiers
FT   CDS_pept        complement(42216..42677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00036"
FT                   /product="possible cAMP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91872"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR4"
FT                   /protein_id="ABG91872.1"
FT                   /translation="MNADESTLPPVLGRLDHQHRLRLAELSTPVRFAAGEFVFRENEPA
FT                   TRCWLLGTGSVVLTTLVPGRGTVALETLHGGDVLGWSWLGARQVWQFDAQATTTTDAAE
FT                   VDVAALEQMALSRPDFGYAVTRALSGVLIARLQSTRARLLDLYANRGDR"
     gtgaacgccg acgaatcgac gctgccacca gtcctcggcc gactcgacca tcaacaccgg        60
     cttcggctcg cggaactcag caccccggtt cgattcgccg cgggggagtt cgtcttccgc       120
     gagaacgaac cggcgacccg gtgctggctg ctcggtaccg gaagtgtcgt cctcaccacg       180
     ctggtacccg gccgcggcac cgtcgcactc gaaaccctgc acggcggtga cgttctcggc       240
     tggtcgtggc tcggcgcccg gcaggtgtgg cagttcgatg cccaggccac gacgaccacc       300
     gatgccgcgg aggtggacgt cgccgcgctc gagcagatgg cgctcagccg ccccgacttc       360
     ggatatgccg tcacccgcgc gttgtccggg gtgctgatcg cccggctgca gtccacccgc       420
     gcgcgactcc tcgatctcta cgcgaatcgc ggcgaccggt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page