(data stored in ACNUC7421 zone)

EMBL: CP000431.PE38

CP000431.PE38        Location/Qualifiers
FT   CDS_pept        complement(43864..44145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91874"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91874.1"
FT                   /translation="MNEKTWSVEIVIDEHDADEGGSRTRAQARLRTRDTHTLVGVGLAR
FT                   RNPADTEIPEIGDELATARALADLAHQLIELTAADVEAATHSRVHLTE"
     atgaacgaga agacgtggtc cgtggagatc gtcatcgacg agcacgacgc cgacgaaggc        60
     gggtccagga cccgggccca agcccggctc cgaacccgcg acacccacac cctggtcggg       120
     gtcgggctcg cccgccggaa tcccgcggac accgagatcc ccgagatcgg cgacgaactg       180
     gccacggcac gtgcgttggc cgacctcgcc caccagttga tcgagctcac cgcggccgac       240
     gtggaagcgg ccacgcacag ccgggtccac ctcaccgagt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page