(data stored in ACNUC7421 zone)

EMBL: CP000431.PE39

CP000431.PE39        Location/Qualifiers
FT   CDS_pept        complement(44222..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91875"
FT                   /db_xref="GOA:Q0SKR1"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91875.1"
FT                   /translation="MTDVITTNQRYMTQTDFMSWRMEEDPILRSTIVAVALLDRRPDQS
FT                   RFVDMMRRAVDLVPLFRRTAIEDPLGLAPPRWADDRDFDLSWHLRRYTLAEPRTWDGVL
FT                   DFARTAEMTAFDKRRPLWEFTILDGLNDGRSALVMKVHHSLTDGVSGMQIAREIVDFTR
FT                   EGTPRPGRTDRATAVPHGGSSRPPSRLSWYRDTAADVTHRAANILGRNSVRLVRAPRAT
FT                   WREATALAGSTLRLTRPVVSTLSPVMTKRSTRRHCAVIDVPVEALAQAAAAAAGSINDA
FT                   FLAAVLLGMAKYHRLHGAEIRELRMTLPISLRTETDPLGGNRISLARFALPTDIDDPAE
FT                   LMRRVHATVDAWRREPAIPFSPMIAGAVNLLPASTLGNMLKHVDFVASNVAGSPVPLFI
FT                   AGSEILHYYAFSPTLGSAFNVTLMSYTTQCCVGINADTDAVPDLATLTESLADGFRAVL
FT                   GLCAKTTDTRVVVAS"
     ttgaccgacg tgatcaccac gaatcagcga tacatgaccc agacggactt catgtcgtgg        60
     cggatggagg aggatccgat cctccgatcg accatcgtgg ctgtcgcgct gctcgaccgc       120
     aggccggatc agagccgatt cgtagacatg atgcgcagag cggtcgacct cgttcccctc       180
     ttccggcgga cggcgatcga ggatccgctg ggcctggcgc cgccgcggtg ggcggacgat       240
     cgagacttcg acctcagctg gcacctgcgc cgctacaccc tcgccgaacc acgaacatgg       300
     gacggggttc tcgacttcgc gcggaccgcc gagatgacgg cgttcgacaa gcgccgcccg       360
     ctctgggagt tcacgattct cgacggactg aacgacggca gatccgccct cgtgatgaaa       420
     gtgcatcact ctctcaccga cggtgtcagt ggaatgcaga tagcccggga gatcgtggat       480
     ttcacccgcg aaggcacacc acgacccggc cggaccgacc gggcgacggc cgtgccgcac       540
     ggtggatcgt ctcgtccgcc gagccgcctc tcctggtacc gggatacggc cgcggacgtg       600
     acccatcggg cggcgaacat tctgggccgc aacagtgttc ggctggttcg tgcgccgagg       660
     gccacctggc gcgaagcaac cgctctcgcc ggctccacac tgcgcctcac gcgtcccgtg       720
     gtttccacgc tgtccccggt gatgacgaaa cgcagcacgc ggcgtcactg cgcggtgatc       780
     gacgtgccgg tggaagcgct cgctcaggca gccgcggcgg ccgccggttc gatcaacgac       840
     gcgttcctgg ctgctgtcct gctgggaatg gcgaagtatc accgactgca cggagccgag       900
     atccgcgaac tgcggatgac gctgccgatc agcctgcgca ccgagacgga cccgctgggc       960
     ggcaaccgca tcagtctggc acgatttgcg ctacccaccg atatcgacga ccccgccgag      1020
     ctgatgcgcc gggtacacgc caccgtcgat gcgtggcgcc gtgagcccgc gattccgttt      1080
     tccccgatga tcgccggcgc cgtgaacctg cttcccgcct cgacactcgg aaacatgctc      1140
     aaacacgtcg acttcgtcgc ctcgaacgtc gccggatccc cggtccctct gttcattgcc      1200
     ggctcggaga tcctgcacta ctacgcgttc agccccacac tcggatcggc gttcaacgtc      1260
     accctgatgt cctacaccac gcaatgctgc gtcgggatca acgccgacac cgatgccgtg      1320
     ccggatctgg cgaccttgac ggagtctctc gccgacgggt ttcgcgccgt cctcggactg      1380
     tgcgcgaaga caaccgacac gagggtggtc gtggcctcat ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page