(data stored in ACNUC7421 zone)

EMBL: CP000431.PE4

CP000431.PE4         Location/Qualifiers
FT   CDS_pept        complement(6182..6940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00004"
FT                   /product="probable dehydrogenase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91840"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU6"
FT                   /protein_id="ABG91840.1"
FT                   /translation="MHKVLPGLGEPTCWASPQGVTPTLRRGAPPVVSEQVVDRIRAELR
FT                   STISNWRTPIFELRRRCVRTRATARVRADLPVCPDTRELGDRTEYGKNLRRGSVREVGL
FT                   THRLFDSVERELGNVAALVFCHCESVDSGRLDTTVESFDRHFAVSTRASWLLIRGYGLR
FT                   FRGQHGTGRVVSLTSDHTVGNLACGASKGAMDRITLAAARELADLGVTCNAINPGPTDT
FT                   GWMNRTAEGAHDHLHISGTPRYTAGLARIW"
     gtgcataagg ttttacctgg attgggtgag ccaacgtgct gggcgagccc acaaggcgtc        60
     accccaacgc tacgccgcgg cgcgcccccc gtggtgtccg agcaggtcgt tgaccgaatc       120
     cgcgctgagc ttcgctcgac aatttcgaat tggcgcacac cgattttcga attgcgccgc       180
     cggtgcgtcc gcacgcgggc aacagcgagg gttcgtgcgg acctcccggt gtgtccggac       240
     accagagaac tcggcgatcg caccgagtac ggaaagaacc tccgccgggg gagcgtgaga       300
     gaagtgggat tgacccatcg gctcttcgac agcgtcgagc gcgaactggg aaacgtcgcc       360
     gcgctggtgt tctgccattg cgagtcggtc gattccggcc ggttggacac cacggtggag       420
     agcttcgatc ggcacttcgc ggtcagtacg cgggcgtcgt ggctgctgat ccgggggtac       480
     gggctgcgat ttcgcggtca gcacggtacc gggcgggtgg tcagcctgac cagcgatcac       540
     accgtcggca acctggcctg tggggcgagc aagggggcga tggaccggat cacgctggcc       600
     gccgcccgtg agcttgccga tctgggagtg acctgtaacg cgatcaatcc cggaccgacc       660
     gacaccgggt ggatgaaccg aacagcagaa ggcgcacatg atcacctgca catctctggg       720
     acgcctcggt ataccgcagg acttgcgcga atctggtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page