(data stored in ACNUC7421 zone)

EMBL: CP000431.PE40

CP000431.PE40        Location/Qualifiers
FT   CDS_pept        complement(45853..46104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91876"
FT                   /db_xref="GOA:Q0SKR0"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR0"
FT                   /protein_id="ABG91876.1"
FT                   /translation="MYDDDVGGWGYALMFTGMALIWGLLIVGIILLIRYVSHPFPAPPG
FT                   EPPHRSAEAVLAERFARGEIDEQEYRNRLSILRAGTTP"
     atgtacgacg acgatgtcgg cggttggggg tatgcactga tgttcaccgg tatggcgctg        60
     atctggggcc tgctgatcgt gggaatcatc ctgttgatcc gctacgtgag tcacccgttc       120
     ccggcaccgc ccggcgagcc accgcatcgc agtgccgaag cggtcctggc cgagcgattc       180
     gcacgcggag agatcgacga gcaggaatac cgcaatcgcc tgagcatcct gcgcgccggg       240
     acgacgccct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page