(data stored in ACNUC7421 zone)

EMBL: CP000431.PE41

CP000431.PE41        Location/Qualifiers
FT   CDS_pept        46395..47549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00041"
FT                   /product="probable penicillin-binding protein"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0016787 - hydrolase activity; GO_process: GO:0000902 -
FT                   cellular morphogenesis; GO_process: GO:0009252 -
FT                   peptidoglycan biosynthesis; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91877"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91877.1"
FT                   /translation="MMLVDPRFGELAGQFFRLFGQPSDGGGALALYLHGEPVVDIWSGW
FT                   AARDTRWQSDTVSVSFSTGKGVASTVLHRLVDRGLIDYDAPVATYWPEFASAGKELVTV
FT                   RDLLTHRAGLHRVRGLVPGRAALFDHDSVVGALASAAPDRRRAVMPGYHAVTFGSLVAE
FT                   LTTRATGSSFTDLVRTEIAEPLGIREFWFQVPAEERHRIAKSFPRITPFGVPWETASFA
FT                   LSCLPVLRNIAHAGMPEGFDELVRNPAIHDYVMPGWNGVFSARALARMYAALANKGMVG
FT                   GRRFLTEDTLAQIGEVQTTARDYVLGIRMNWRLGYHAAFVASRNQYPHAFGHYGLGGSG
FT                   AFADPETGLSVAFVTNRMGGALTPLADLRLAKLGAQAESIARRL"
     atgatgctcg tcgatcctcg tttcggtgag ctggccggtc agttcttccg gttgttcggg        60
     cagcctagcg acgggggcgg cgccctcgcg ctctacctgc acggtgagcc cgtggtcgac       120
     atctggtcgg gatgggccgc gcgcgacacg cgctggcagt ccgacaccgt ctcggtgtcc       180
     ttctccaccg gcaagggcgt tgcgagcacg gtgctacacc ggctggtgga ccgcggactg       240
     atcgactacg acgcacccgt tgccacgtat tggcccgagt tcgcgagtgc cggcaaggag       300
     ttggtgacgg tgcgggattt gttgacgcac cgggctggtc tgcatcgtgt gcgcggactg       360
     gtaccggggc gggcggcgct gttcgatcac gacagcgtcg tcggcgctct cgcatccgcg       420
     gcaccggatc gtcgccgcgc cgtcatgccg ggttatcacg ccgtcacgtt cggatcgctg       480
     gtcgcggaac tcaccactcg ggcgaccggt tcgtcgttca ccgacctcgt ccgcaccgag       540
     atcgccgaac ccctcggaat ccgcgaattc tggttccagg ttcccgcgga ggaacgtcac       600
     cgcatcgcca agtccttccc ccgcatcact ccgttcgggg tgccgtggga gaccgcgtcc       660
     ttcgccctgt cgtgcctgcc tgtgttgcgg aacatcgcac acgcaggcat gccggagggg       720
     ttcgacgaac tggtccgcaa tccggccatt cacgactatg tgatgcccgg ctggaacggt       780
     gtcttcagcg cccgtgccct cgcccgaatg tatgcggcgc tcgcgaacaa gggcatggtg       840
     ggcggaagga ggttcctgac ggaggacacg ctcgcgcaga tcggtgaggt gcagacgacg       900
     gcacgcgact atgtgctcgg tatccggatg aactggcgcc tgggctacca tgcggcgttc       960
     gtcgccagcc gcaatcagta tccacacgca ttcggccact acggactcgg tggttccggc      1020
     gcgttcgcgg acccggagac ggggctgtcg gtggcgttcg tgacgaacag gatgggtggt      1080
     gcactgaccc cgctcgccga cctgcggctg gcaaaactgg gcgcgcaagc ggaatcgatc      1140
     gcccggcgac tgtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page