(data stored in ACNUC7421 zone)

EMBL: CP000431.PE42

CP000431.PE42        Location/Qualifiers
FT   CDS_pept        complement(47559..48437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00042"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91878"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91878.1"
FT                   /translation="MTYAPTDAVVASETVTMTGGVADHEYSRATSGHRRRCRRSPGYHY
FT                   SEAALLFQNEFAEEVEKSAHEILDRAQQHVKSAVPDVTVSCSTHPGPAGPALAGLSAHA
FT                   EMVVVGSTGAGALQSILTGSTVLQVVNRAHCPVTVFRSEAPSPVPDHRPVVVGVDGSDL
FT                   SSLAITTAVEFATFFEVPLLAVHGWGAGDLPERPAALPMVNWAVVEEEQSVLMAENLAG
FT                   WREKCPDLQLTTVIEQAGPAELILEYARDAQLVVVGSHGHNRLAGAFLGSTSQNLLHHV
FT                   ACLITICRRAS"
     atgacctatg cccctaccga cgccgttgtc gcatctgaga ccgtgacgat gaccggagga        60
     gttgcggacc atgagtattc tcgcgcaacg tcaggccatc gtcgtcggtg tcgacggagt       120
     ccgggatatc actacagcga agccgcgctt ctcttccaga acgagttcgc cgaagaagtc       180
     gagaagtctg cccacgagat cctggatcgc gcccaacagc acgtgaagag cgccgtcccc       240
     gacgtcaccg tgtcgtgcag cacccatccc ggccccgcgg gaccggcact cgcaggattg       300
     agcgcgcacg ccgagatggt ggtggtggga tccaccggtg cgggtgcact gcaatcgatc       360
     ctcaccggct ccaccgtcct gcaggtggtc aaccgtgcgc actgtccggt taccgtgttc       420
     cgatcggagg caccgtcccc ggtacccgac caccgtcctg tcgtcgtcgg cgtcgacggc       480
     agtgacctga gctcactcgc catcaccacg gccgtcgaat tcgccacgtt cttcgaggta       540
     ccgctcctcg cggtgcacgg ctggggcgcc ggcgacctcc cggagcgccc tgccgccctg       600
     ccgatggtga actgggccgt cgtcgaagaa gaacaatccg ttctgatggc ggagaatctc       660
     gccggctggc gcgagaaatg cccggatcta caactgacga ccgtcatcga acaagctggt       720
     ccggccgagc tgatcctcga gtacgctcgc gacgcacaac tcgtcgtcgt cggcagccac       780
     ggccacaacc gcctggccgg agcgtttctg ggatcgacca gtcagaattt gctccatcac       840
     gtcgcctgcc tgatcacgat ctgccgccga gcgagctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page