(data stored in ACNUC7421 zone)

EMBL: CP000431.PE43

CP000431.PE43        Location/Qualifiers
FT   CDS_pept        complement(48504..48797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91879"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ7"
FT                   /protein_id="ABG91879.1"
FT                   /translation="MSTPSEVGGSAPRSGPERVLADGSRRRVRAEHHARPPVGQRARIG
FT                   PVDSVVIRLRHWRLCVSRRRPRSLSTTLRWGIHGELRGVVSLRIQPTMATTE"
     atgtcgactc cttctgaggt tgggggctcg gcgccgcgat ctgggcccga gcgtgttctg        60
     gccgacggtt cacgtcgacg ggtgcgcgcc gaacatcacg cgcgcccacc agtcggccag       120
     cgggctcgga tcgggccagt cgattcggtc gtcatccgtc tccggcactg gcggctgtgt       180
     gtgtctcgtc gtcgaccgag atccctgtcg acgacgttga ggtgggggat tcatggcgaa       240
     ctccgagggg tcgtgtcact tcggattcaa ccaacgatgg cgaccaccga gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page