(data stored in ACNUC7421 zone)

EMBL: CP000431.PE46

CP000431.PE46        Location/Qualifiers
FT   CDS_pept        complement(53107..53709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00046"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91882"
FT                   /db_xref="GOA:Q0SKQ4"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ4"
FT                   /protein_id="ABG91882.1"
FT                   /translation="MTIDQALRWWRLAPWSRNPLMRATDRCDSVVAAVLITVVLIVVPF
FT                   AAAFGTVTYTGLAERSHTELQTRHAQSAVLVDDPRQVVVADARSRSPETQDRGTAQWKA
FT                   PDGTLRSTAVETRPGTHRGDTVTVWVDTNGNVVAEPRSGVQNAAIAVSAALSVWAGAAV
FT                   GALLLYSGVRWISGRSRMRQWDREWNDLGRTPGWPVS"
     atgaccatcg atcaggcact gcgctggtgg cgtctggcgc cctggagtcg aaatcccctc        60
     atgcgtgcca ccgaccgttg cgactccgtc gtcgcggccg tcctgatcac cgtcgtcctg       120
     atcgtggtcc cgttcgcggc ggcgttcgga accgtgacgt acaccggttt ggccgaacgg       180
     tctcacaccg aacttcagac gaggcatgca cagtccgccg ttctcgtcga tgatccgcga       240
     caggtggtgg tcgccgacgc gcgcagccgc tcaccggaga cgcaggaccg tgggacagct       300
     cagtggaagg caccggacgg caccctgcgc tcgaccgccg tggaaaccag acccgggacg       360
     caccgcggcg acacggtgac ggtgtgggtg gacacgaacg gcaacgtcgt cgccgagccc       420
     cggtcgggag tgcagaacgc ggcgatcgcc gtgagcgcgg ccctgtcggt gtgggcgggt       480
     gcggcggtcg gcgccctcct gctgtactcc ggggtgcggt ggatcagcgg ccgaagccgg       540
     atgcggcagt gggatcggga atggaacgat ctcggccgca caccgggatg gccggtcagt       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page